DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and CG10140

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:279 Identity:55/279 - (19%)
Similarity:90/279 - (32%) Gaps:117/279 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly  1616 TTTSSLPPLSCSTGYQY------------------LPHPTNCHKYIHCSNGHELIMECPANLYWD 1662
            ||.|:|...|.::|.:|                  ||...:|::|..|.:|..:.::|.    |.
  Fly    29 TTDSTLETDSTTSGLEYGLITGNLSICGNVADNVFLPFVGDCNRYYLCRSGQAIELQCE----WP 89

  Fly  1663 YHKFVCSGDSGVCYNDTENS--NPEEKVCGP-----GVDFLAHPTDCTMYLQCSNGVALERKCPD 1720
            |.           :|....|  :|.:..|.|     .....::...||.|:.|..|..:.|:|.|
  Fly    90 YE-----------FNANTQSCVHPGDADCLPTCEAFNFSTFSYQRTCTRYVLCYYGKPVLRQCQD 143

  Fly  1721 PLYWNPEIKSCD--------------WSNKY----------------CTNLRASQSISCAAGMNF 1755
            .|.:|.....||              :||.|                |.| ...:..:|.||::|
  Fly   144 GLQYNSATDRCDFPQNVDCVESECSIYSNAYHLRYVPSKVSCQKYFICGN-GIPREQTCTAGLHF 207

  Fly  1756 NV--------FQSDC--------------------------------------SKYVKCFGLRGV 1774
            :.        .:|||                                      ..|..|....|:
  Fly   208 STKCDCCDIPSKSDCQIPAVERKVQQLSRLSPVTTVGICPPSGVHFYVHESRRDAYYYCVDGHGL 272

  Fly  1775 VMSCNSGLYWNPVSQVCEK 1793
            |:.|::||:::|..|.|.:
  Fly   273 VLDCSAGLWYDPTVQECRE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 11/67 (16%)
ChtBD2 1626..1668 CDD:214696 11/59 (19%)
ChtBD2 1688..1734 CDD:214696 14/64 (22%)
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 12/57 (21%)
CBM_14 111..161 CDD:279884 12/49 (24%)
CBM_14 178..222 CDD:279884 7/44 (16%)
CBM_14 246..295 CDD:279884 10/46 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 1 1.000 - - FOG0012676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.