DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and CG10725

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:193 Identity:52/193 - (26%)
Similarity:73/193 - (37%) Gaps:57/193 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1632 YLPHPTNCHKYIHCSNGHELIMECPANLYWDYHKFVC--------------SGDSGVCYNDTENS 1682
            ::|...||.||..|.|...:..|||.:.|:|.....|              .|.|..||:.|   
  Fly    35 FVPQVGNCSKYFLCMNEIAVPRECPTDYYFDARDQECVPLMEVECIGSCKNRGLSSFCYDRT--- 96

  Fly  1683 NPEEKVCGPGVDFLAHPTDCTMYLQCSNGVALERKCPDPLYWNPEIKSCDWSNKYCTNLRASQSI 1747
                               ||.|:.|.:|..:.|:|.|.|.:|.....||:          .|.:
  Fly    97 -------------------CTKYVLCFDGTPVIRQCSDGLQYNALTDRCDY----------PQYV 132

  Fly  1748 SCAAGM---NFN----VF---QSDCSKYVKCFGLRGVVMSCNSGLYWNPVSQVCE-KSRRFCT 1799
            .|...:   |.|    ||   ::.|.||..|......|.:|.|||.:||.:|.|: .|:..||
  Fly   133 DCVDNLCSRNNNPDDIVFIPSKARCDKYYICMDGLPQVQNCTSGLQYNPSTQSCDFPSKVNCT 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 12/29 (41%)
ChtBD2 1626..1668 CDD:214696 12/35 (34%)
ChtBD2 1688..1734 CDD:214696 12/45 (27%)
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 13/37 (35%)
CBM_14 83..134 CDD:279884 18/82 (22%)
CBM_14 150..192 CDD:279884 15/41 (37%)
ChtBD2 216..264 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 1 1.000 - - FOG0012676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.