DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and CG10154

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster


Alignment Length:270 Identity:66/270 - (24%)
Similarity:99/270 - (36%) Gaps:68/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1577 STAGQVSTSTTLVYDTTSSPIPSSSRSTTLEPSS-----SSSPETTTSSLPPLSCSTGY------ 1630
            :..|.|:....|.|....|.......:|..|..|     ..:|:...   |..||..||      
  Fly    56 NVCGNVADGVYLPYVGNCSKYIECENNTIKEVGSCLDLAKDNPDICD---PNKSCELGYDPVLQV 117

  Fly  1631 -------QYLP-----------HPTNCHKYIHCSNGHELIMECPANLYW-------DYHKFV-CS 1669
                   |.||           :...|.||:.|..|..::.:|...|.:       |:.::| | 
  Fly   118 CTYMEEVQCLPTCESFRLSSFCYDNTCTKYVLCYYGKPVLRQCHDGLQYNNATDRCDFPEYVDC- 181

  Fly  1670 GDSGVCYNDTENSNPEEKVCGPGVDFLAHPTDCTMYLQCSNGVALERKCPDPLYWNPEIKSCDWS 1734
                |..:.:....||:      :.:|.....|:.|..||||...|::|...|.:||..|.||::
  Fly   182 ----VANDCSATFQPED------IIYLGSKASCSKYYVCSNGHPWEQQCAPGLAYNPSCKCCDFA 236

  Fly  1735 -NKYC--------------TNLRASQSISC-AAGMNFNVFQSDCSKYVKCFGLRGVVMSCNSGLY 1783
             |..|              |.||.: .|.| ..|.:|...:|....|..|...|||.:.|..|||
  Fly   237 KNVNCTIDAVARNILPYSRTPLRRA-DIKCPLMGTHFFPHKSRRDAYYYCVEGRGVTLDCTPGLY 300

  Fly  1784 WNPVSQVCEK 1793
            ::|..:.|.:
  Fly   301 YDPKVEDCRR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 10/29 (34%)
ChtBD2 1626..1668 CDD:214696 15/73 (21%)
ChtBD2 1688..1734 CDD:214696 15/45 (33%)
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 8/49 (16%)
CBM_14 197..239 CDD:279884 15/41 (37%)
ChtBD2 263..311 CDD:214696 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 1 1.000 - - FOG0012676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.