DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and obst-G

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_648529.1 Gene:obst-G / 39355 FlyBaseID:FBgn0036228 Length:279 Species:Drosophila melanogaster


Alignment Length:220 Identity:45/220 - (20%)
Similarity:75/220 - (34%) Gaps:70/220 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1633 LPHPTNCHKYIHCSNGHELIMECPANLYWDYHKFVCSGDSGV-C--------YNDTENSNPEE-- 1686
            ||...:|..|..|::|:.:...|..|..::.....|.....| |        .:||.:|..:|  
  Fly    40 LPMFGSCKGYYVCADGNAVTGTCEKNTLFNPLTLHCDDPDNVDCIFDGKDNIVDDTSSSESDEDD 104

  Fly  1687 -------------------------KVCGPGVD--FLAHPTDCTMYLQCSNGVALERKCPDPLYW 1724
                                     |:|....|  .|.....|..|..|.......|.|||..::
  Fly   105 DEEMAKTDPPVTVKATKKPRPTTLDKMCAGKKDGVMLTKNGSCQEYYVCKAKKPHLRSCPDKQHF 169

  Fly  1725 NPEIKSCDWSNKYCTNLRASQSISCAAGMNFN----------------------VFQSDCSKYVK 1767
            :|..:.|         ::||:: .|:.|...|                      ..:|||.|::.
  Fly   170 SPTRRIC---------MKASEA-KCSGGTRENKESDGPATTGGVCSDEKENSLVAHRSDCGKFML 224

  Fly  1768 CFGLRGVVMSCNSGLYWNPVSQVCE 1792
            |..:..:||.|.:||::|..:..|:
  Fly   225 CSNMMFLVMDCPTGLHFNIATSRCD 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 10/29 (34%)
ChtBD2 1626..1668 CDD:214696 8/34 (24%)
ChtBD2 1688..1734 CDD:214696 12/47 (26%)
obst-GNP_648529.1 CBM_14 32..83 CDD:279884 10/42 (24%)
CBM_14 132..184 CDD:279884 14/61 (23%)
CBM_14 204..256 CDD:279884 12/46 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.