DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and CG17826

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster


Alignment Length:221 Identity:66/221 - (29%)
Similarity:86/221 - (38%) Gaps:61/221 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1625 SCSTGYQYLPHPTNCHKYIHCSNGHELIMECPANLYWDYHKFVC-SGDSGVCYNDTENSNPEEKV 1688
            :|:.| :....||||..|:.||||:.:..:|....|::.....| ..|.|:|.|..|.|...   
  Fly   137 TCTDG-ELKVDPTNCAGYLACSNGNWVSKQCADGAYFNAILETCVQDDEGICVNCKEGSTKP--- 197

  Fly  1689 CGPGVDFLAHPTDCTMYLQCSNGVALERKCPDPLYWNPEIKSCDWSNKYC--------------- 1738
                   ||   |||||..||.|..:.:.|....|||.:.:.||..|..|               
  Fly   198 -------LA---DCTMYEICSGGKYVTKSCDSGYYWNSQSEVCDVDNGQCNGNGTTCTDGELKVD 252

  Fly  1739 -TN----LRASQ----SISCAAGMNFNVF----------------------QSDCSKYVKCFGLR 1772
             ||    |..|.    |..||.|..|||.                      .:||:.|..|.|.:
  Fly   253 PTNCAGYLACSNGNWVSKQCADGAYFNVTLETCVQDDEGICVNCKEGSTKPLADCTMYEICSGGK 317

  Fly  1773 GVVMSCNSGLYWNPVSQVCEKSRRFC 1798
            .|..||:||.|||..|:||:.....|
  Fly   318 YVTKSCDSGYYWNSQSEVCDVDNGQC 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 14/29 (48%)
ChtBD2 1626..1668 CDD:214696 13/41 (32%)
ChtBD2 1688..1734 CDD:214696 16/45 (36%)
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696
CBM_14 145..184 CDD:279884 12/38 (32%)
CBM_14 251..290 CDD:279884 11/38 (29%)
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.