Sequence 1: | NP_996064.1 | Gene: | Muc68E / 2768990 | FlyBaseID: | FBgn0053265 | Length: | 1799 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648528.1 | Gene: | CG17826 / 39354 | FlyBaseID: | FBgn0036227 | Length: | 751 | Species: | Drosophila melanogaster |
Alignment Length: | 221 | Identity: | 66/221 - (29%) |
---|---|---|---|
Similarity: | 86/221 - (38%) | Gaps: | 61/221 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 1625 SCSTGYQYLPHPTNCHKYIHCSNGHELIMECPANLYWDYHKFVC-SGDSGVCYNDTENSNPEEKV 1688
Fly 1689 CGPGVDFLAHPTDCTMYLQCSNGVALERKCPDPLYWNPEIKSCDWSNKYC--------------- 1738
Fly 1739 -TN----LRASQ----SISCAAGMNFNVF----------------------QSDCSKYVKCFGLR 1772
Fly 1773 GVVMSCNSGLYWNPVSQVCEKSRRFC 1798 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Muc68E | NP_996064.1 | ChtBD2 | <1761..1791 | CDD:214696 | 14/29 (48%) |
ChtBD2 | 1626..1668 | CDD:214696 | 13/41 (32%) | ||
ChtBD2 | 1688..1734 | CDD:214696 | 16/45 (36%) | ||
CG17826 | NP_648528.1 | CBM_14 | 36..74 | CDD:279884 | |
ChtBD2 | <89..124 | CDD:214696 | |||
CBM_14 | 145..184 | CDD:279884 | 12/38 (32%) | ||
CBM_14 | 251..290 | CDD:279884 | 11/38 (29%) | ||
CBM_14 | 357..396 | CDD:279884 | |||
CBM_14 | 463..502 | CDD:279884 | |||
CBM_14 | 563..610 | CDD:279884 | |||
CBM_14 | 621..670 | CDD:279884 | |||
CBM_14 | 697..749 | CDD:279884 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D33909at6656 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.020 |