DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and CG33985

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster


Alignment Length:216 Identity:58/216 - (26%)
Similarity:91/216 - (42%) Gaps:48/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1533 PIPD----TSTTVNQDTTTDESSTVVTTTNIPKESTTLGDSTLSPGENSTAGQVSTSTTLVYDTT 1593
            |:.|    |.:.|.::.|||.|||.:|:     ||:|:                  ||.::  ||
  Fly    74 PMGDIDCRTGSEVQRENTTDSSSTEITS-----ESSTI------------------STVVI--TT 113

  Fly  1594 SSPIPSSSRSTTLEPSSSSSPETTTSSL------------PPLSCSTGYQYLPHPTNCHKYIHCS 1646
            .:|    |...||.||.:.|..::|:|:            |.|...:....||:..:|..|..|.
  Fly   114 LAP----SAVVTLRPSVNQSGASSTTSVSPAIEIIVTNVCPQLDNQSRIALLPNQNSCSDYYICY 174

  Fly  1647 NGHELIMECPANLYWDYHKFVCSGDSGV-CYNDTENSNPEEKVCGPGVDFLAHPTDCTMYLQCSN 1710
            .|..|.|.|..:|:::.....|.....| |...|  .||.|:.....:|...|..:|..:.||.:
  Fly   175 RGVALPMSCATSLHFNSLTGKCDHPENVRCLAMT--YNPREQCKRHVIDVYPHSDNCNYFYQCRS 237

  Fly  1711 GVALERKCPDPLYWNPEIKSC 1731
            |..:.::||....|:.|.:||
  Fly   238 GYLMVQQCPFFYGWDYEKRSC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696
ChtBD2 1626..1668 CDD:214696 10/41 (24%)
ChtBD2 1688..1734 CDD:214696 12/44 (27%)
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 58/216 (27%)
CBM_14 160..202 CDD:279884 11/41 (27%)
ChtBD2 215..259 CDD:214696 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.