DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and CG33986

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster


Alignment Length:243 Identity:47/243 - (19%)
Similarity:87/243 - (35%) Gaps:53/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1605 TLEPSSSSSPETTTSSLPPLSCSTGY--QYLPHPTNCHKYIHC-SNGHELIMECPANLYWDYHKF 1666
            |..||..::..|...|...: |:...  :::.|..:||.:..| .||..::..||..:.::....
  Fly    21 TWRPSKPTNSVTIRQSGSRI-CANHLVGEFVEHAEDCHMFYLCVENGDAVLASCPPTMLFNSESR 84

  Fly  1667 VCSGDSGV-CYNDTE------------NSNPEEKV------CGPGVD---------FLAHPTDCT 1703
            :|...:.| |.|:|:            :.:|...|      |...|:         ::...:.|.
  Fly    85 LCDSATNVKCRNETDPIETPPFDGGNGDGDPNNMVTDAATYCSTLVEQQQSSDRIVYVGSSSSCR 149

  Fly  1704 MYLQCSNGVALERKCPDPLYWNPEIKSCDWSNK-YCT-------------------NLRASQSIS 1748
            .|..|..|.|:.::|...|:||.....||...: .||                   ...:|..|.
  Fly   150 KYYICYYGQAILQECSSQLHWNAMTGKCDIPERAQCTVGGQEDMPTNGNSGFPSGGTAISSDLIH 214

  Fly  1749 CAA-GMNFNVFQSDCSKYVKCFGLRGVVMSCNSGLYWNPVSQVCEKSR 1795
            |.| |.:.......|..::.|......:..|....:::..::.|:.||
  Fly   215 CPAYGQHLYPHMQRCEFFIYCVKGHASLQQCPFYYFFDIATKSCQWSR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 3/29 (10%)
ChtBD2 1626..1668 CDD:214696 9/44 (20%)
ChtBD2 1688..1734 CDD:214696 14/60 (23%)
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 10/50 (20%)
CBM_14 141..185 CDD:279884 11/43 (26%)
ChtBD2 213..261 CDD:214696 8/47 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.