DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and CG32302

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:242 Identity:55/242 - (22%)
Similarity:79/242 - (32%) Gaps:94/242 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1623 PLSCSTGYQYLPHPTNCHKYIH------------CSNG----------------HELIMECPANL 1659
            |.||.....: |.|.:|.:| |            ||||                .:.|.|     
  Fly    90 PFSCQQAGLF-PDPYDCRRY-HECSDQSVDTPRICSNGAGYSTLTGTCVLPRESEQCIQE----- 147

  Fly  1660 YWDYHKFVC--SGDSG----------VCYNDTENS-NPEEKVCGPGVDFLAH---PTDCTM---- 1704
                 :|.|  ||..|          ||.|||.|| .|....|..|..|.::   |...:|    
  Fly   148 -----QFTCSRSGQVGGWAPDNRYFYVCVNDTANSLYPLMMKCHEGFVFNSYSCVPDTRSMRSIQ 207

  Fly  1705 -----------------------YLQCSNGVALERKCPDPLYWNPEIKSCDWSNKY-CTNLRASQ 1745
                                   |.:|.:|......||.....:|:|.:|.....| |::.   :
  Fly   208 AMESHTCMNNDRYQCPFRTSEIEYCKCVDGELEVMTCPAGFQIDPKILTCVTDRIYQCSDF---E 269

  Fly  1746 SISCAAGMNFNVFQSDCSKYVKCFGLRGVVMSCNSGLYWNPVSQVCE 1792
            .:||.     ||...|  :|..|...:..:.||..|.|:|..::.|:
  Fly   270 ILSCP-----NVSTKD--EYCICIDHQLQIYSCPMGQYFNAETRKCQ 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 8/29 (28%)
ChtBD2 1626..1668 CDD:214696 13/69 (19%)
ChtBD2 1688..1734 CDD:214696 13/75 (17%)
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 9/51 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.