Sequence 1: | NP_996064.1 | Gene: | Muc68E / 2768990 | FlyBaseID: | FBgn0053265 | Length: | 1799 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_728732.1 | Gene: | CG32302 / 38293 | FlyBaseID: | FBgn0052302 | Length: | 313 | Species: | Drosophila melanogaster |
Alignment Length: | 242 | Identity: | 55/242 - (22%) |
---|---|---|---|
Similarity: | 79/242 - (32%) | Gaps: | 94/242 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 1623 PLSCSTGYQYLPHPTNCHKYIH------------CSNG----------------HELIMECPANL 1659
Fly 1660 YWDYHKFVC--SGDSG----------VCYNDTENS-NPEEKVCGPGVDFLAH---PTDCTM---- 1704
Fly 1705 -----------------------YLQCSNGVALERKCPDPLYWNPEIKSCDWSNKY-CTNLRASQ 1745
Fly 1746 SISCAAGMNFNVFQSDCSKYVKCFGLRGVVMSCNSGLYWNPVSQVCE 1792 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Muc68E | NP_996064.1 | ChtBD2 | <1761..1791 | CDD:214696 | 8/29 (28%) |
ChtBD2 | 1626..1668 | CDD:214696 | 13/69 (19%) | ||
ChtBD2 | 1688..1734 | CDD:214696 | 13/75 (17%) | ||
CG32302 | NP_728732.1 | CBM_14 | 94..144 | CDD:279884 | 9/51 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |