DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and CG32302

DIOPT Version :10

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:242 Identity:55/242 - (22%)
Similarity:79/242 - (32%) Gaps:94/242 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1623 PLSCSTGYQYLPHPTNCHKYIH------------CSNG----------------HELIMECPANL 1659
            |.||.....: |.|.:|.:| |            ||||                .:.|.|     
  Fly    90 PFSCQQAGLF-PDPYDCRRY-HECSDQSVDTPRICSNGAGYSTLTGTCVLPRESEQCIQE----- 147

  Fly  1660 YWDYHKFVC--SGDSG----------VCYNDTENS-NPEEKVCGPGVDFLAH---PTDCTM---- 1704
                 :|.|  ||..|          ||.|||.|| .|....|..|..|.::   |...:|    
  Fly   148 -----QFTCSRSGQVGGWAPDNRYFYVCVNDTANSLYPLMMKCHEGFVFNSYSCVPDTRSMRSIQ 207

  Fly  1705 -----------------------YLQCSNGVALERKCPDPLYWNPEIKSCDWSNKY-CTNLRASQ 1745
                                   |.:|.:|......||.....:|:|.:|.....| |::.   :
  Fly   208 AMESHTCMNNDRYQCPFRTSEIEYCKCVDGELEVMTCPAGFQIDPKILTCVTDRIYQCSDF---E 269

  Fly  1746 SISCAAGMNFNVFQSDCSKYVKCFGLRGVVMSCNSGLYWNPVSQVCE 1792
            .:||.     ||...|  :|..|...:..:.||..|.|:|..::.|:
  Fly   270 ILSCP-----NVSTKD--EYCICIDHQLQIYSCPMGQYFNAETRKCQ 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 rne <158..303 CDD:236766
MDN1 300..1293 CDD:444083
rne <1358..1503 CDD:236766
ChtBD2 1626..1668 CDD:214696 13/69 (19%)
ChtBD2 1688..1734 CDD:214696 13/75 (17%)
ChtBD2 <1761..1791 CDD:214696 8/29 (28%)
CG32302NP_728732.1 CBM_14 94..144 CDD:426342 9/51 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.