DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and CG13806

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_647708.1 Gene:CG13806 / 38292 FlyBaseID:FBgn0035325 Length:297 Species:Drosophila melanogaster


Alignment Length:187 Identity:43/187 - (22%)
Similarity:61/187 - (32%) Gaps:49/187 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1574 GENSTAGQVSTSTTLVYDTTSSPIPSSSRSTTLEPSSSSSPETTTSSLPPLSCSTGYQYLPH--- 1635
            |....|..|.......:|.|:.       ..||         |.|.|:    |.....|.|:   
  Fly   126 GATLVAAAVDCGNDKAFDATTG-------QCTL---------TLTDSV----CLQRQYYCPNAGH 170

  Fly  1636 ----PTNCHKYIHCSNGHELIMECPANLYWDYHK---------FVCSGDSGVCYNDT-------E 1680
                |||.:.:..|.:.....:.....:|...|:         :||...|.|....|       |
  Fly   171 VAAWPTNPNIFYVCKSTVNQNLNDTIVIYPSLHRCNDGETFVDYVCRSGSNVLPPSTDDPSVIIE 235

  Fly  1681 NSNPEEKVCGPG----VDFLAHPTDCTMYLQCS--NGVALERKCPDPLYWNPEIKSC 1731
            :.|.::....|.    |..:|...||..|..||  ||......||:..|:.||:.||
  Fly   236 DPNDDDFSVLPNTCQHVGLMADGNDCRKYYYCSALNGTLRHMDCPNGTYYRPELSSC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696
ChtBD2 1626..1668 CDD:214696 9/57 (16%)
ChtBD2 1688..1734 CDD:214696 17/50 (34%)
CG13806NP_647708.1 CBM_14 105..158 CDD:279884 10/51 (20%)
ChtBD2 247..293 CDD:214696 16/46 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.