DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and obst-B

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:293 Identity:62/293 - (21%)
Similarity:89/293 - (30%) Gaps:105/293 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1475 PEDDTTVEDSTPIPEETTTVAQETTYDPEGSTTRDDTTVAIETTTEKPEDDTTAEGSTPIPDTST 1539
            |.:...|::::.:|:...|.| |..|:|               |.|.||.:..      .||:..
  Fly    56 PRNRDPVQEASVVPKSKQTAA-EKEYEP---------------TEECPEPNGF------YPDSKQ 98

  Fly  1540 TVNQDTTTDESSTVVTTTNIPKESTTLGDSTLSPGENSTAGQVSTSTTLVYDTTSSPIPSSSRST 1604
            ........|.    |.|..:..:.....|  .||        :.....|.|:     |....||.
  Fly    99 CDKYYACLDG----VPTERLCADGMVFND--YSP--------IEEKCDLPYN-----IDCMKRSK 144

  Fly  1605 TLEPSSSSSPETTTSSLPPLSCSTGYQYLPH--PTNCHKYIHCSNGHELIMECPANLYWDYHKFV 1667
            ...|.            |.|.|.....|..|  |..|.|:..|.:|...::.|||.|.:      
  Fly   145 LQTPQ------------PSLHCPRKNGYFGHEKPGICDKFYFCVDGQFNMITCPAGLVF------ 191

  Fly  1668 CSGDSGVCYNDTENSNPEEKVCG----PGV---------DF---------------LAHPTDCTM 1704
                           ||:..:||    .||         ||               .|.|.||..
  Fly   192 ---------------NPKTGICGWPDQVGVTGCKSEDVFDFECPKVNESIAVTHPRYADPNDCQF 241

  Fly  1705 YLQCSNGVALERK-CPDPLYWNPEIKSCDWSNK 1736
            :..|.||....|. |.....::.|.::|||:.|
  Fly   242 FYVCVNGDLPRRNGCKLGQVFDEEKETCDWARK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696
ChtBD2 1626..1668 CDD:214696 12/43 (28%)
ChtBD2 1688..1734 CDD:214696 18/74 (24%)
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 11/74 (15%)
CBM_14 156..204 CDD:279884 15/68 (22%)
CBM_14 233..278 CDD:279884 14/42 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.