DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and cpg-2

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_498551.3 Gene:cpg-2 / 175991 WormBaseID:WBGene00015102 Length:524 Species:Caenorhabditis elegans


Alignment Length:317 Identity:68/317 - (21%)
Similarity:99/317 - (31%) Gaps:99/317 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1525 DTTAEGSTPIPDTSTTVNQDTTTDESSTVVTTTNIPKESTTLGDSTLSPGENSTAGQVSTSTTLV 1589
            :|:.|||......::.......:.|.|         .|::..|....| ||.|.:|:.:....  
 Worm    85 ETSGEGSGESSGEASGEGSGEASGEGS---------GEASGEGSGEAS-GEGSGSGEETVENV-- 137

  Fly  1590 YDTTSSPIPSSSRSTTLEPSSSSSPETTTSSLPPLSCSTGYQYLPHPTNCHKYIHCSNGHELIME 1654
                         ...||..:.||...||                      .|..|:......:.
 Worm   138 -------------CENLEDGAYSSGGCTT----------------------YYFFCTTNTARFLS 167

  Fly  1655 CPANLYWDYHKFVC----------------------------------SGD-SGVCYNDT----- 1679
            ||..|::|.....|                                  ||: ||....::     
 Worm   168 CPTPLFYDADSQKCIWKSLVEECKEDLTITDGSGETSGEGSGEASGEASGEGSGEASGESSGQGS 232

  Fly  1680 -----ENSNPEEKVCGPGVDFLAHPTD-C-TMYLQCSNGVALERKCPDPLYWNPEIKSCDWSNKY 1737
                 |.|...|..|....|.: ||.. | |.:|.||.|:|....||..|.:||.|..|||....
 Worm   233 GEASGEGSGELEPTCEGKADGI-HPNGVCSTNFLTCSGGIARIMDCPASLVFNPTILVCDWPRDV 296

  Fly  1738 --CTNLRASQSISCAAGMNFNVFQSDCSKYVKCFGLRGVVMSCNSGLYWNPVSQVCE 1792
              |..|...|. :|.....|: |....|.:..|...|.:||.|.:||.::..:..|:
 Worm   297 AECAGLPTPQP-TCEEDGYFS-FGQCSSSFTACTNGRAIVMFCPAGLKFSESTVRCD 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 8/29 (28%)
ChtBD2 1626..1668 CDD:214696 6/41 (15%)
ChtBD2 1688..1734 CDD:214696 19/47 (40%)
cpg-2NP_498551.3 CBM_14 24..76 CDD:279884
CBM_14 138..190 CDD:279884 13/73 (18%)
ChtBD2 245..293 CDD:214696 19/48 (40%)
CBM_14 311..359 CDD:279884 11/42 (26%)
CBM_14 403..454 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.