DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and LOC108179232

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:XP_021322084.1 Gene:LOC108179232 / 108179232 -ID:- Length:185 Species:Danio rerio


Alignment Length:171 Identity:36/171 - (21%)
Similarity:49/171 - (28%) Gaps:53/171 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1596 PIPSSSRSTTLEPSSSSSPETTTSSLPPLSCSTGY----QYLPHPT-NCHKYIHCSNGHELIMEC 1655
            |.|..:.|..|...|.||         ...|..|:    ..|..|: ||....:|:.|.:..|. 
Zfish    16 PCPPGTWSNALGSKSVSS---------CWLCPAGFYCNSSGLIQPSGNCAPGFYCAGGAKTAMP- 70

  Fly  1656 PANLYWDYHKFVCSGDSGVCYNDTENSNPEEKVCGPGVDFLAHPTDCTMYLQCSNGV----ALER 1716
                           |.|:    |.|..|....|         |..|...|.|.:|.    ....
Zfish    71 ---------------DDGL----TGNRCPTRYYC---------PQGCASPLHCPDGTHSNSTGSA 107

  Fly  1717 KCPD-PLYW----NPEIKSCDWSNKYCTNLRASQSISCAAG 1752
            :|.| |..|    ..:::.|. ...||........:.|..|
Zfish   108 ECSDCPTGWLCLEGEDLQLCP-KGHYCVGGTVEDILPCPPG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696
ChtBD2 1626..1668 CDD:214696 9/46 (20%)
ChtBD2 1688..1734 CDD:214696 11/54 (20%)
LOC108179232XP_021322084.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.