DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and Gm30500

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:XP_017171830.1 Gene:Gm30500 / 102632425 MGIID:5589659 Length:614 Species:Mus musculus


Alignment Length:271 Identity:59/271 - (21%)
Similarity:84/271 - (30%) Gaps:69/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1500 YDPEGSTTRDDTTVAIETTTEKPEDDTTAEGS-TPIPDTSTTVNQDTTTDESSTVVTTTNIPKES 1563
            :|.:..|:.:....|..|..:.|......||| .|||.|            ..:...|:.:|   
Mouse   299 FDLDNYTSTNCLCPATATGGKCPAGSYCPEGSPEPIPCT------------PGSFCATSGLP--- 348

  Fly  1564 TTLGDSTLSPGENSTAGQV----STSTTLVYDTTSSPIPSSSRSTTLEPSSSSSPETTTSSLPPL 1624
                    :|.....||..    |.|...|.:.|..|.|..|.........:..|..|.||||..
Mouse   349 --------TPTGPCQAGYFCIGGSESPAPVDEVTGGPCPPGSYCPVASHKPTPCPVGTFSSLPEQ 405

  Fly  1625 SCSTGYQYLPHPTNCHKY-IHCSNGHELIMECPANLYWDYHKFVCSGDSGVCYNDTENSNPEEKV 1688
            :.|:..:..|....|.:. :...:|.     |||..|              |.:.|         
Mouse   406 TTSSTCRSCPSGFYCKEAGLQAPSGW-----CPAGYY--------------CDSST--------- 442

  Fly  1689 CGPGVDFLAHPTDCTMYLQCSNGVALERKCPDPLYWNP-----EIKSCDW--SNKYCTNLRASQ- 1745
             ||..||..:|.....|.......|:...||...| .|     .|..|..  :.|:|:....|. 
Mouse   443 -GPVQDFSLYPCPRGYYCPVGTTKAMYHSCPVGTY-GPRKGLTSITECQLCPAGKFCSLAGISAP 505

  Fly  1746 --SISCAAGMN 1754
              .:..|.|:|
Mouse   506 TGKVQTALGLN 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696
ChtBD2 1626..1668 CDD:214696 8/42 (19%)
ChtBD2 1688..1734 CDD:214696 13/52 (25%)
Gm30500XP_017171830.1 TNFRSF 394..518 CDD:389949 35/153 (23%)
CRD1 394..411 CDD:276900 7/16 (44%)
CRD2 414..451 CDD:276900 13/65 (20%)
CRD3 453..506 CDD:276900 11/53 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.