DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and znf512

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:XP_005160899.1 Gene:znf512 / 101882368 ZFINID:ZDB-GENE-041014-346 Length:656 Species:Danio rerio


Alignment Length:319 Identity:60/319 - (18%)
Similarity:113/319 - (35%) Gaps:88/319 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 REDDTTVAIETTTEKPEDDTTVEDSTPIPEESTT-VAQETTYDPEGSTTREDDTTVAIETTTEKP 467
            :.:.:.||.|:...||:.:       |:||.:.: .|:..:....|...||   ..:.|...|.|
Zfish   365 KNEHSPVAEESEEVKPQKE-------PVPERTQSGRAKRLSAQVAGFYLRE---IASEELLKEWP 419

  Fly   468 E---------DDTTVEDSTP-IPEESTTVAQETTYDPEGSTTREDDTTVAIETTTEKPEDD---- 518
            :         ||..::.|.| :|..|.            .|.|:....|.:....:.|...    
Zfish   420 KRKVQRDLVPDDRKLKYSRPGLPSFSQ------------DTLRKWKNEVKLHKKVQCPNKGCGCF 472

  Fly   519 --------------TTAEDSTPIPEESTTVAQDTTNDPEG------STTREDDTTVAIETTTEKP 563
                          |..|..|  .:....:.:...|...|      |...:|...|..::.:.|.
Zfish   473 YTSVSGLKAHLGLCTLGEFET--GKYKCLICKKEFNSESGVKYHINSIHAQDWFVVRSKSKSLKF 535

  Fly   564 E--DDTTAEDSTPIPEESTTVAQETTYDPEG-STTREDDTTVAIE----TTTEK----------- 610
            |  |.|.|::.:.:|...:    ||...|:| |:|.:|..|.|:.    |.|::           
Zfish   536 EKLDKTQAKEDSDLPSPDS----ETLSFPQGSSSTWQDRQTSAVPISSGTATQELKMKRKERRNQ 596

  Fly   611 -------REDDTTVEDSTPIPEESTTVAQDTTNDPEGSTTREDDTTVAIETTTEKPEDD 662
                   :|.|............|.:.:..::::.|..|.::|:.|::...::::||.|
Zfish   597 QKRKASGQEKDCYEFSGNESQSSSGSSSSSSSSESEPETHKQDEWTLSRPLSSQRPESD 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696
ChtBD2 1626..1668 CDD:214696
ChtBD2 1688..1734 CDD:214696
znf512XP_005160899.1 SFP1 <224..368 CDD:227516 0/2 (0%)
SFP1 <392..519 CDD:227516 23/143 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3552
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.