DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk5 and asic4b

DIOPT Version :9

Sequence 1:NP_996138.2 Gene:ppk5 / 2768987 FlyBaseID:FBgn0053289 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_999951.1 Gene:asic4b / 407667 ZFINID:ZDB-GENE-040513-6 Length:558 Species:Danio rerio


Alignment Length:430 Identity:94/430 - (21%)
Similarity:161/430 - (37%) Gaps:106/430 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 QIPFPTITVCNMNQAKKSKVEHLMPGSIRYAMLQKTCYKESNFSQYMDTQHRNETFSNF------ 119
            ::.||.||:||:|:.:.|            |:.....|..:|.:.......:....|..      
Zfish   111 ELTFPAITLCNVNRFRFS------------ALTDADIYHLANLTGLPPKSRKGHRPSELQYPPPN 163

  Fly   120 ILDVSEKCA----DLIVSCIFHQQRIPCTDIFRETFVDEGLCCIFNVLHPYYLYKFKSPYIRDFT 180
            :||:.::..    |::.||.|..|.....| |...:...|.|..||               .:.|
Zfish   164 MLDIFQRTGHQLEDMLKSCNFSGQNCSSED-FSVVYTRYGKCYTFN---------------GNKT 212

  Fly   181 SSDRFADIAVDWDPISGYPQRLPSSYYPRPGVGVGTSMGLQIVLNGHVDDYF------CSSTNGQ 239
            |                 |:|:      |.|   ||..||:::|:...|:|.      ..:|...
Zfish   213 S-----------------PKRV------RQG---GTGNGLEMMLDIQQDEYLPIWRETNETTLEA 251

  Fly   240 GFKILLYNPIDQPRMKESGLPVMIGHQTSFRIIARNVEATPSIRNIHRTKRQCIFSDEQELLFYR 304
            |.::.:::..:.|.:.:.|..|..|.||......:.:...|      :....|..|.|..:..|.
Zfish   252 GIRVQIHSQNEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLP------QPWGNCRASSEPVIPGYD 310

  Fly   305 YYTRRNCEAECDSMFFLRLCSCIPYYLPLIYPNASVCDVFHFECLNRAESQIFDLQSSQCKEFCL 369
            .|:...|...|:|....|.|:|...::|   .:|.:|.....:|:::|.:.:.......|.  |.
Zfish   311 TYSVSACRLHCESTQVQRECNCRMVHMP---GDADICAPSKIKCVDKALASLQKSTGDSCP--CE 370

  Fly   370 TSCH--------DLIFFPDAFSTPF-SQKDVKAQTNYLTNFSSEYMRKNLAVVN-FFHTDNYFRS 424
            |.|:        .::..|...|..: |:|..|         |.||:|.|..::: ||...||...
Zfish   371 TPCNLTRYGKELSMVKIPSRGSARYLSRKYQK---------SEEYIRDNFLILDIFFEALNYETI 426

  Fly   425 SVRTSY--TGPTEYMASTGGIMSLMIGFSVIFLAEII-YI 461
            ..:.:|  .|   .:...||.|.|.||.|::.:.||: ||
Zfish   427 EQKKAYDIAG---LLGDIGGQMGLFIGASILTILEILDYI 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk5NP_996138.2 ASC 4..460 CDD:279230 92/427 (22%)
asic4bNP_999951.1 ASC 54..497 CDD:295594 94/430 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586641
Domainoid 1 1.000 101 1.000 Domainoid score I6864
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4956
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100105
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.