powered by:
Protein Alignment ppk5 and F58G6.8
DIOPT Version :9
Sequence 1: | NP_996138.2 |
Gene: | ppk5 / 2768987 |
FlyBaseID: | FBgn0053289 |
Length: | 474 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001023246.2 |
Gene: | F58G6.8 / 3565898 |
WormBaseID: | WBGene00010278 |
Length: | 162 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 18/66 - (27%) |
Similarity: | 34/66 - (51%) |
Gaps: | 9/66 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 WWIKLYFAIIFALVLFVAVNLAVGIYNKWDSTPVIIGISSKMTPIDQIPFPTITVCNMNQAKKSK 79
|.|.|..:.:..:.:|.::..:...:| |::.:: |.:|..|||:||.||.|..|.|:
Worm 84 WSIILIVSAVAFVYMFYSIAASYLAFN------VVVNLN---TGLDSEPFPSITFCNTNPYKLSE 139
Fly 80 V 80
:
Worm 140 M 140
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ppk5 | NP_996138.2 |
ASC |
4..460 |
CDD:279230 |
18/66 (27%) |
F58G6.8 | NP_001023246.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160162357 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4294 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D303969at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.