DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk5 and asic4

DIOPT Version :9

Sequence 1:NP_996138.2 Gene:ppk5 / 2768987 FlyBaseID:FBgn0053289 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_031749131.1 Gene:asic4 / 100486325 XenbaseID:XB-GENE-940165 Length:535 Species:Xenopus tropicalis


Alignment Length:464 Identity:92/464 - (19%)
Similarity:170/464 - (36%) Gaps:90/464 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SWWIKLYFAIIFALVLFVAVNLAVGIYNKWDSTPVIIGISSKMTPIDQIPFPTITVCNMNQAKKS 78
            |.|.   .|.:.:|:.|:.......:|  :...|.:..:..::  :.::.||.||:||:|:.:.|
 Frog    67 SLWA---LAFLASLLFFLYQVAKCALY--YLEHPHVTAVDEEV--MGEMIFPAITICNINRFRHS 124

  Fly    79 KVEHLMPGSIRYAMLQKTCYKESNFSQYMDTQHRNETFSNFILDVSEKCADLIVSCIFHQQRIPC 143
            .:..  |.....|.|.....|:....:..|..:.:....:.:.....:.|:::.||.|.......
 Frog   125 ALTD--PDIYHLANLTGLPPKDREGHRDSDLMYDDPDMLDIVNRTGHQLAEMLKSCNFSGDSCSA 187

  Fly   144 TDIFRETFVDEGLCCIFNVLHPYYLYKFKSPYIRDFTSSDRFADIAVDWDPISGYPQRLPSSYYP 208
            .: |...|...|.|..||                        ||                 ..:|
 Frog   188 QN-FSVVFTRYGKCYTFN------------------------AD-----------------KKHP 210

  Fly   209 RPGVGVGTSMGLQIVLNGHVDDY--FCSSTN----GQGFKILLYNPIDQPRMKESGLPVMIGHQT 267
            :.....|...||:|:|:...::|  ....||    ..|.::.:::..:.|.:.:.|..|..|.||
 Frog   211 KVSRQGGMGNGLEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQDEPPYIHQMGFGVSPGFQT 275

  Fly   268 SFRIIARNVEATPSIRNIHRTKRQCIFSDEQELLFYRYYTRRNCEAECDSMFFLRLCSCIPYYLP 332
            ......:.:...|......|:.    ...|:.|..|..|:...|..:|:....:|.|:|...::|
 Frog   276 FVSCQEQRMTYLPQPWGNCRSS----IPGEEFLSGYSTYSISACRLQCEKEAVIRKCACRMVHMP 336

  Fly   333 LIYPNASVCDVFHFECLNRAESQIFDLQSSQCKEFCLTSCH--------DLIFFPDAFSTPFSQK 389
               .|.::|....:.|.:.....:.:..|.:|.  |.|.|:        .::..|:         
 Frog   337 ---GNETICSPVMYMCADHILDNMVEDTSEKCS--CPTPCNLTRYSKEISMVRIPN--------- 387

  Fly   390 DVKAQTNYLT---NFSSEYMRKNLAVVN-FFHTDNYFRSSVRTSYTGPTEYMASTGGIMSLMIGF 450
              |....||.   |.:..|:|:|..|:: ||...||.....:.:|..|: .:...||.|.|.||.
 Frog   388 --KGSARYLARKYNKNETYIRENFLVLDIFFEALNYETIEQKKAYDLPS-LLGDIGGQMGLFIGA 449

  Fly   451 SVIFLAEII 459
            |.:.:.||:
 Frog   450 SFLTILEIL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk5NP_996138.2 ASC 4..460 CDD:279230 92/464 (20%)
asic4XP_031749131.1 ASC 39..514 CDD:413546 92/464 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5830
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I4647
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.160

Return to query results.
Submit another query.