DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trl and zbtb8b

DIOPT Version :9

Sequence 1:NP_001261846.1 Gene:Trl / 2768981 FlyBaseID:FBgn0013263 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001315276.1 Gene:zbtb8b / 550243 ZFINID:ZDB-GENE-050417-42 Length:497 Species:Danio rerio


Alignment Length:387 Identity:82/387 - (21%)
Similarity:138/387 - (35%) Gaps:51/387 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPF----LLDLLKNTPCKHPVVMLA 76
            |.:.|:|.:...|......||::...||.|.||:.:|.|:|.:    |:..|::...:|....|.
Zfish     6 YLSRLLSELNEQRKRNFFCDCSIIVEGRVFKAHRNILFASSGYFRALLVHYLQDNGQRHSTASLD 70

  Fly    77 GVNANDLEALLEFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTHSIQL-QHMIPQ 140
            .|.|.....:|:|:|.|.:.:....:..::.||..|.:..:.  ...| .|...|::: ...|.:
Zfish    71 IVTAEAFSFILDFLYSGRLDLRSDNVIEIMSAASYLQMTDVV--NFCK-GYIKSSLEICNREIER 132

  Fly   141 HHDQDQL-------------IATIATAPQQTVHAQVVEDIHHQGQILQAT-TQTNAAGQQQTIVT 191
            ..::|.|             :|:.:.|.|:|  .||.|.:........|. |..|.:.:......
Zfish   133 LRERDGLDNSATPVSVTCTPVASTSEADQRT--CQVTEALSPDDAPTAAVCTPANTSSKDSESEN 195

  Fly   192 TDAAKHDQAVIQAFLPARKRKPRVKKMSP------TAPKIS---KVEGMDTIMGTPTSSHGSGSV 247
            :..|..:...|.|.|........|...:|      ..|||.   ..||        .||..|...
Zfish   196 SQGAFPNHTPINAPLKVSPGPDLVNSSTPGLLLGLVHPKIEYDPDEEG--------ESSRESKDA 252

  Fly   248 QQVLGENGAEGQLLSSTPIIKSEGQKVETIVTMDPNNMIPVTSANAATGEITPAQGATGSSG-GN 311
            ....|.|....:.::::|...:|...|.  ....|....|..   ...|.:.|.:....|.. |.
Zfish   253 ALYQGPNHDGERTVNTSPAPSTEHSSVS--FANCPMKQFPDV---LYRGGMNPNRDEHFSQNLGY 312

  Fly   312 TSGVLSTPKAKRAKHPPGTEKPRSRSQSEQPA---TCPICYAVIRQSRNLRRHLELRHFAKP 370
            .||.....:......|.|.| .::...::.|.   .||.|....:|...|:||:......:|
Zfish   313 VSGFSRGDEVLGPAGPCGME-VQNDWYADDPGRLHKCPFCPYTAKQKGILKRHIRCHTGERP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrlNP_001261846.1 BTB 27..117 CDD:279045 24/93 (26%)
BTB 35..118 CDD:197585 23/86 (27%)
GAGA 319..372 CDD:150045 12/55 (22%)
zbtb8bNP_001315276.1 BTB 14..120 CDD:279045 26/108 (24%)
BTB 25..123 CDD:197585 25/100 (25%)
C2H2 Zn finger 348..368 CDD:275368 7/19 (37%)
zf-H2C2_2 361..385 CDD:290200 4/13 (31%)
C2H2 Zn finger 376..397 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.