DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trl and lolal

DIOPT Version :9

Sequence 1:NP_001261846.1 Gene:Trl / 2768981 FlyBaseID:FBgn0013263 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster


Alignment Length:119 Identity:48/119 - (40%)
Similarity:76/119 - (63%) Gaps:2/119 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPFLLDLLKNTPCKHPVV 73
            :.|.|.|:.|::|::.:.||......|.|||..|::..|||:||.|.||:...||:..|.|||::
  Fly     8 FFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHPII 72

  Fly    74 MLAGVNANDLEALLEFVYRGEVSVDHAQLPSLLQAAQCLNIQGLA--PQTVTKD 125
            :|..|:...|:|:|||:|.|||:|...|||:.|:.|..|.::|||  |.::.::
  Fly    73 ILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKRE 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrlNP_001261846.1 BTB 27..117 CDD:279045 39/89 (44%)
BTB 35..118 CDD:197585 38/82 (46%)
GAGA 319..372 CDD:150045
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 37/82 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10615
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.