DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trl and Zbtb37

DIOPT Version :9

Sequence 1:NP_001261846.1 Gene:Trl / 2768981 FlyBaseID:FBgn0013263 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001100661.1 Gene:Zbtb37 / 304918 RGDID:1308731 Length:504 Species:Rattus norvegicus


Alignment Length:574 Identity:111/574 - (19%)
Similarity:189/574 - (32%) Gaps:205/574 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPFLLD---- 61
            |::..:....|...|:..|::|.:..||..|.|.|..:...|::|.|||:||.|:||:..|    
  Rat     1 MTMEKSGNIQLEIPDFSNSVLSHLNQLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPYFRDHMSL 65

  Fly    62 ----LLKNTPCKHPVVMLAGVNANDLEALLEFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTV 122
                .:..:..|:|.|         .|.||.|.|.|.:.:..|.:.|.|.||..|          
  Rat    66 NEMSTVSISVIKNPTV---------FEQLLSFCYTGRICLQLADIISYLTAASFL---------- 111

  Fly   123 TKDDYTTHSIQLQHMIPQHHDQDQLIATIATAPQQTVHAQVVEDIHH-------QGQILQATTQT 180
                      |:||:|.:                   ..|::|.||.       :.::.|..|:.
  Rat   112 ----------QMQHIIDK-------------------CTQILEGIHFKINVAEVEAELSQTRTKH 147

  Fly   181 NAAGQQQTIVTTD-----AAKHD------QAVIQAFLPARKRKPRVKKMSP-TAPKISKVEGMDT 233
            .....:...||.:     :.:|:      :..:.|.|..|:..|..:..|| ...:.|.|||.:.
  Rat   148 PERPPESHRVTPNLTRSLSPRHNASKGNWRGQVSAVLDIRELSPPEESTSPQIIEQSSDVEGREP 212

  Fly   234 IM------------GTPTSSHGSGSVQQVLG---------------ENGAEGQLLSSTPIIKSEG 271
            |:            |.......||...:|||               ||...|:          :|
  Rat   213 ILRINRAGQWYVETGIADQGPQSGDEVRVLGAVHIKTENLEEWLGPENQPSGE----------DG 267

  Fly   272 QKVETIVTMDPNNMIPVTSANAATGEITPAQGATG--------------SSGGNTSGVLSTPKAK 322
            ...|.:..     |:..|:.:.:.|:.:...|::|              |..|:...:....:| 
  Rat   268 SSAEEVAA-----MVIDTTGHGSVGQESYTLGSSGAKVARPTSSEVDRFSPSGSVVSMTERHRA- 326

  Fly   323 RAKHPPGTEKPRS-RSQSEQPA---------------------------TCPICYAVIRQSRNLR 359
            |::.|...::|:. .||.|:.|                           ||..|.....|..:|.
  Rat   327 RSESPGRMDEPKQLSSQVEESAMMGVSAYVEYLREQEVSERWFRYNPRLTCIYCAKSFNQKGSLD 391

  Fly   360 RHLELRHFAKP------GVKKEKKSK--------SGN--------------DTTLDSSMEMN--- 393
            ||:.|.....|      |.|..:|.:        :||              ...|:.....|   
  Rat   392 RHMRLHMGITPFVCRMCGKKYTRKDQLEYHIRKHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPG 456

  Fly   394 -TTAEGDNTVGSDGA-----GGAGSAGGQSSATSGKKSSSGSSGSGSGALSSSG 441
             ...||.:::..:..     ...||...:.:...|:        |..|::|::|
  Rat   457 CIPLEGPHSISPETTVTSRQAEEGSPSHEETVAPGE--------SAQGSVSTTG 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrlNP_001261846.1 BTB 27..117 CDD:279045 31/97 (32%)
BTB 35..118 CDD:197585 27/90 (30%)
GAGA 319..372 CDD:150045 17/86 (20%)
Zbtb37NP_001100661.1 BTB_POZ_ZBTB37 9..131 CDD:349531 43/169 (25%)
C2H2 Zn finger 377..397 CDD:275368 6/19 (32%)
zf-H2C2_2 389..414 CDD:404364 7/24 (29%)
zf-C2H2 403..425 CDD:395048 3/21 (14%)
C2H2 Zn finger 405..425 CDD:275368 3/19 (16%)
zf-H2C2_2 418..440 CDD:404364 2/21 (10%)
DUF4764 <429..>497 CDD:406387 8/75 (11%)
C2H2 Zn finger 433..451 CDD:275368 1/17 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.