DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trl and BCL6B

DIOPT Version :9

Sequence 1:NP_001261846.1 Gene:Trl / 2768981 FlyBaseID:FBgn0013263 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_862827.2 Gene:BCL6B / 255877 HGNCID:1002 Length:479 Species:Homo sapiens


Alignment Length:415 Identity:86/415 - (20%)
Similarity:141/415 - (33%) Gaps:111/415 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGVNA 80
            :.:.::..:..||..|.|.|.||..||:...|||.||.|.|.|...:.:..         |||..
Human    20 HSSDVLGNLNELRLRGILTDVTLLVGGQPLRAHKAVLIACSGFFYSIFRGR---------AGVGV 75

  Fly    81 NDL------EA-----LLEFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTHSIQL 134
            :.|      ||     ||:|:|...:.:..|..|::|.||..|.::              |.:|.
Human    76 DVLSLPGGPEARGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQME--------------HVVQA 126

  Fly   135 QHMIPQHHDQDQLIA---------TIATAP------QQTVHAQVVEDIH--HQGQILQATTQTNA 182
            .|...|...:...|:         |..|||      :...|.....:..  .||....|:....|
Human   127 CHRFIQASYEPLGISLRPLEAEPPTPPTAPPPGSPRRSEGHPDPPTESRSCSQGPPSPASPDPKA 191

  Fly   183 AG--QQQTIVTTDAAKHDQAVI----------QAFLPARKRKPRVKKMSPTAPKISKVEGMDTIM 235
            ..  :.:.||....|....:::          ||.||:..........|.::.:...:.|..:.:
Human   192 CNWKKYKYIVLNSQASQAGSLVGERSSGQPCPQARLPSGDEASSSSSSSSSSSEEGPIPGPQSRL 256

  Fly   236 GTPTSSHGSGSVQQVLGENGAEGQLLSSTP-IIKSEGQKVETIVTMDPNNMIPVTSANAATGEIT 299
             :||::    :||...|..       :||| ::.|:.|                .::.:.:....
Human   257 -SPTAA----TVQFKCGAP-------ASTPYLLTSQAQ----------------DTSGSPSERAR 293

  Fly   300 PAQGATGSSGGNTSGVLSTPKAKRAKHPPGTEKP-------------------RSRSQSEQPATC 345
            |..|:...|..|...|........:..|...:||                   |:....|:|..|
Human   294 PLPGSEFFSCQNCEAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLASHRTVHTGEKPYHC 358

  Fly   346 PICYAVIRQSRNLRRHLELRHFAKP 370
            .||.|...:..||:.|..:....||
Human   359 SICGARFNRPANLKTHSRIHSGEKP 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrlNP_001261846.1 BTB 27..117 CDD:279045 33/100 (33%)
BTB 35..118 CDD:197585 29/93 (31%)
GAGA 319..372 CDD:150045 15/71 (21%)
BCL6BNP_862827.2 BTB_POZ 19..132 CDD:365784 36/134 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..190 8/46 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..259 6/49 (12%)
C2H2 Zn finger 330..350 CDD:275368 1/19 (5%)
COG5048 354..>411 CDD:227381 10/30 (33%)
C2H2 Zn finger 358..378 CDD:275368 7/19 (37%)
zf-H2C2_2 370..395 CDD:372612 5/14 (36%)
C2H2 Zn finger 386..406 CDD:275368
zf-C2H2 412..434 CDD:333835
C2H2 Zn finger 414..434 CDD:275368
zf-H2C2_2 427..451 CDD:372612
C2H2 Zn finger 442..460 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.