DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trl and ZBTB38

DIOPT Version :9

Sequence 1:NP_001261846.1 Gene:Trl / 2768981 FlyBaseID:FBgn0013263 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_005247313.1 Gene:ZBTB38 / 253461 HGNCID:26636 Length:1196 Species:Homo sapiens


Alignment Length:473 Identity:89/473 - (18%)
Similarity:167/473 - (35%) Gaps:102/473 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGV-N 79
            :..:::|.:...|..|.|.|.|:......|.||..||.|:|.:    .||....|.:.:.:.| .
Human    16 HSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAASSLY----FKNIFWSHTICISSHVLE 76

  Fly    80 ANDLEA-----LLEFVYRGEVSVDHAQ-LPSLLQAAQCLNIQGLAPQTVTKDDY----------- 127
            .:||:|     :|.::|...|.|...: :..|..|.:.|.|..|  :.:|..::           
Human    77 LDDLKAEVFTEILNYIYSSTVVVKRQETVTDLAAAGKKLGISFL--EDLTDRNFSNSPGPYVFCI 139

  Fly   128 TTHSIQLQHMIPQHHDQDQLIATIATAPQQTVHAQVVE-----------DIHHQGQILQATTQTN 181
            |...:..:....:.|::    ..|...|:.|....::|           |:....:.:..:.:|.
Human   140 TEKGVVKEEKNEKRHEE----PAITNGPRITNAFSIIETENSNNMFSPLDLRASFKKVSDSMRTA 200

  Fly   182 AAGQQQTIVTTDA------AKHDQAVIQAFLPARKRKPRVKKMSPTAPKISKVEGMDTIMGTPTS 240
            :...::|.|..:|      |:|..|| .:...|.:.:| |::...::|..:..|..:.:...|.:
Human   201 SLCLERTDVCHEAEPVRTLAEHSYAV-SSVAEAYRSQP-VREHDGSSPGNTGKENCEALAAKPKT 263

  Fly   241 SHGSGSVQQVLGENGAEGQL----LSSTPIIKSEGQKVETIVT--MDPNNMIPVTSANAATGEIT 299
            .....:.......:.|...:    :|:..:.:....:...::|  ..|||...|..:.....:.:
Human   264 CRKPKTFSIPQDSDSATENIPPPPVSNLEVNQERSPQPAAVLTRSKSPNNEGDVHFSREDENQSS 328

  Fly   300 PAQGATG-------------SSGGNTSGVLSTPKAKRAKHPPGTEKPRSRSQSEQPATCPICYAV 351
            ...|...             |...::|.:||   |....|.|          :::|..|..|...
Human   329 DVPGPPAAEVPPLVYNCSCCSKAFDSSTLLS---AHMQLHKP----------TQEPLVCKYCNKQ 380

  Fly   352 IRQSRNLRRHLEL----RHFAKPGVKKEKKSKSGNDTTLDSSMEMNTTAEGDNTVGSDGAGGAGS 412
            ......|.||.::    .|...||         ||...|          |...|:|.:|....|.
Human   381 FTTLNRLDRHEQICMRSSHMPIPG---------GNQRFL----------ENYPTIGQNGGSFTGP 426

  Fly   413 AGGQSSATSGKKSSSGSS 430
            ....|....|:.||:||:
Human   427 EPLLSENRIGEFSSTGST 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrlNP_001261846.1 BTB 27..117 CDD:279045 27/96 (28%)
BTB 35..118 CDD:197585 24/89 (27%)
GAGA 319..372 CDD:150045 11/56 (20%)
ZBTB38XP_005247313.1 BTB 24..123 CDD:279045 28/104 (27%)
BTB 35..131 CDD:197585 26/101 (26%)
C2H2 Zn finger 345..365 CDD:275368 5/22 (23%)
C2H2 Zn finger 374..393 CDD:275368 5/18 (28%)
C2H2 Zn finger 463..483 CDD:275368
C2H2 Zn finger 491..511 CDD:275368
C2H2 Zn finger 519..537 CDD:275368
C2H2 Zn finger 1013..1033 CDD:275368
zf-H2C2_2 1026..1049 CDD:290200
zf-C2H2 1039..1061 CDD:278523
C2H2 Zn finger 1041..1061 CDD:275368
zf-H2C2_2 1053..1077 CDD:290200
C2H2 Zn finger 1069..1089 CDD:275368
zf-H2C2_2 1082..1106 CDD:290200
C2H2 Zn finger 1097..1121 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.