DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trl and Zbtb44

DIOPT Version :9

Sequence 1:NP_001261846.1 Gene:Trl / 2768981 FlyBaseID:FBgn0013263 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_006510278.1 Gene:Zbtb44 / 235132 MGIID:1925123 Length:616 Species:Mus musculus


Alignment Length:450 Identity:88/450 - (19%)
Similarity:158/450 - (35%) Gaps:131/450 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPFLLDLL--------KNTPCKHPV 72
            :...::..:.:||..|...|.|:....:.|.|||:||.|.|.|....|        ||      |
Mouse    13 HSQEMLGKLNMLRNDGHFCDITIRVQDKIFRAHKVVLAACSDFFRTKLVGQTEDENKN------V 71

  Fly    73 VMLAGVNANDLEALLEFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTHSIQLQHM 137
            :.|..|.......|||:.|...:|::...:..:|.||..:.:..:|.   |..::...||     
Mouse    72 LDLHHVTVTGFIPLLEYAYTATLSINTENIIDVLAAASYMQMFSVAS---TCSEFMKSSI----- 128

  Fly   138 IPQHHDQDQLIATIATAPQQTVHAQVVEDIHHQGQILQATTQTNAAGQQQTI--VTTDAAKHDQA 200
                     |..|..:.|::::.|         ||  :.::..|...:..:|  |:::.:..::.
Mouse   129 ---------LWNTPNSQPEKSLDA---------GQ--ENSSNCNFTSRDGSISPVSSECSAVERT 173

  Fly   201 VIQAFLPARKRKPRVKKMSPTAP-KIS------------------KVEGMDTIMGTP-TSSHGSG 245
            :.......||||..: .|||.:| |.|                  :.:.:|:.:..| |...|..
Mouse   174 IPVCRESRRKRKSYI-VMSPESPVKCSTQTSSPQVLNSSASYAENRSQPVDSSLAFPWTFPFGID 237

  Fly   246 SVQQVLGENGAEGQLLSSTPIIKSEGQKVETIVTMDPNNMI------------------------ 286
            ...|......||.......|.....|::|...||.:.....                        
Mouse   238 RRIQPEKAKQAENTRTLELPGPSEAGRRVADYVTCESTKPTLPLGTEEDVRVKVERLSDEEVHEE 302

  Fly   287 ---PVTSANAATGE---------------ITPAQGATGS-SGGNTSGV------LST-------P 319
               ||:::.::..:               |:|...:.|| ..|.|.|:      .||       .
Mouse   303 VSQPVSASQSSLSDQQTVPGSEPVQEDLLISPQSSSIGSVDEGVTEGLPTLQSTSSTNAHADDDD 367

  Fly   320 KAKRAKHP---------PGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKP 370
            :.:..::|         ..||:| |.:..::|..||.|.....:.:||::|:.:....||
Mouse   368 RLENVQYPYQLYIAPSTSSTERP-SPNGPDRPFQCPTCGVRFTRIQNLKQHMLIHSGIKP 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrlNP_001261846.1 BTB 27..117 CDD:279045 28/97 (29%)
BTB 35..118 CDD:197585 25/90 (28%)
GAGA 319..372 CDD:150045 13/60 (22%)
Zbtb44XP_006510278.1 BTB_POZ_ZBTB44 15..130 CDD:349537 32/137 (23%)
zf-C2H2 399..421 CDD:333835 6/21 (29%)
C2H2 Zn finger 401..421 CDD:275368 6/19 (32%)
zf-H2C2_2 413..438 CDD:372612 4/13 (31%)
C2H2 Zn finger 429..449 CDD:275368
C2H2 Zn finger 457..476 CDD:275368
zf-C2H2 487..508 CDD:333835
C2H2 Zn finger 489..511 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.