DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trl and NACC2

DIOPT Version :9

Sequence 1:NP_001261846.1 Gene:Trl / 2768981 FlyBaseID:FBgn0013263 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_653254.1 Gene:NACC2 / 138151 HGNCID:23846 Length:587 Species:Homo sapiens


Alignment Length:413 Identity:79/413 - (19%)
Similarity:139/413 - (33%) Gaps:96/413 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPFLLDLLKNTPCK 69
            |:.:..:...::|.:::..:...|..|...|.::...|::|.||:.||.|:|.:..||.... .|
Human     1 MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGN-SK 64

  Fly    70 HPVVMLAGVNANDLEALLEFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTHSIQL 134
            ....:...|.....:.:|.|.|.|.::         :.|::.|.:.           ||...:|:
Human    65 SAFELPGSVPPACFQQILSFCYTGRLT---------MTASEQLVVM-----------YTAGFLQI 109

  Fly   135 QHMIPQHHDQDQLIATIATAPQQTVHAQVVEDIHHQGQILQATTQTNAAGQQQTIVTTDAAKHDQ 199
            ||::.:..|    :....::|.......|:||...:.|......|..||.....:|:....    
Human   110 QHIVERGTD----LMFKVSSPHCDSQTAVIEDAGSEPQSPCNQLQPAAAAAAPYVVSPSVP---- 166

  Fly   200 AVIQAFLPARKR-KPRVKKMSPTAPKISKVEGMDTIMGTPTSSHGSGSVQQVLGENGAEGQLLSS 263
                  :|...| |....::.|..|.::....::|   .|..     .|....|...|.|.....
Human   167 ------IPLLTRVKHEAMELPPAGPGLAPKRPLET---GPRD-----GVAVAAGAAVAAGTAPLK 217

  Fly   264 TPIIKSEGQKVETIVTMDPN-NMIPVTSANAATGEITPAQGATGSSGGNTSGVLSTPKAKRAKHP 327
            .|.:...|  |.::.|:.|. ..:|.            .||...|.|.::   |.|..:..:.|.
Human   218 LPRVSYYG--VPSLATLIPGIQQMPY------------PQGERTSPGASS---LPTTDSPTSYHN 265

  Fly   328 PGTEK--------------------PRSRSQSEQPATCPI----CYAVIRQSRNL---------- 358
            ...|:                    ..|.:..|:|...|:    |..:.|....|          
Human   266 EEDEEDDEAYDTMVEEQYGQMYIKASGSYAVQEKPEPVPLESRSCVLIRRDLVALPASLISQIGY 330

  Fly   359 RRHLELRHFAKPGVKKEKKSKSG 381
            |.|.:|.....||.|.|..:.||
Human   331 RCHPKLYSEGDPGEKLELVAGSG 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrlNP_001261846.1 BTB 27..117 CDD:279045 21/89 (24%)
BTB 35..118 CDD:197585 19/82 (23%)
GAGA 319..372 CDD:150045 13/86 (15%)
NACC2NP_653254.1 BTB 20..120 CDD:279045 27/124 (22%)
BTB 31..114 CDD:197585 24/103 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..272 9/46 (20%)
BEN 373..450 CDD:214981
TIM_phosphate_binding 496..>581 CDD:304361
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5230
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.