DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7377 and CG33267

DIOPT Version :9

Sequence 1:NP_996052.1 Gene:CG7377 / 2768978 FlyBaseID:FBgn0036176 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_996046.2 Gene:CG33267 / 2768969 FlyBaseID:FBgn0053267 Length:94 Species:Drosophila melanogaster


Alignment Length:95 Identity:84/95 - (88%)
Similarity:87/95 - (91%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYSCVLLLLATVACFLVSLSSGSTTTTSTDA-TTTTTTASSSDTTTTTASSSDTTTTTTASPSS 64
            ||||||||||||||||||||||.|||||:||| ||||||||||||||||.|||||||||.|| ||
  Fly     1 MKYSCVLLLLATVACFLVSLSSASTTTTTTDATTTTTTTASSSDTTTTTTSSSDTTTTTEAS-SS 64

  Fly    65 SKKKHVIHYKRKVHRPKKVKTIRRKKNRSG 94
            .||||||||||||||||||:.|||.:||||
  Fly    65 KKKKHVIHYKRKVHRPKKVRKIRRNRNRSG 94



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469320
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016656
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.