DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsen34 and SEN2

DIOPT Version :9

Sequence 1:NP_001036605.2 Gene:Tsen34 / 2768977 FlyBaseID:FBgn0053260 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_013206.1 Gene:SEN2 / 850795 SGDID:S000004095 Length:377 Species:Saccharomyces cerevisiae


Alignment Length:276 Identity:64/276 - (23%)
Similarity:111/276 - (40%) Gaps:34/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GTGFVFNVDDYMELRSKHRIMGAPVGTANTKGWSPNQSTLPVELSKFETQLLLDENIAKLVDKSK 72
            |||.....:...:.|::.| :|......:.:|.:.:.:...:.|.|...|    ..:.:|..|.:
Yeast    82 GTGQFSRSEPTWKARTEAR-LGLNDTPLHNRGGTKSNTETEMTLEKVTQQ----RRLQRLEFKKE 141

  Fly    73 DLKAKPTAEKLEECK----ADFESRLL-GQEEALKTEKLRETERYMDKILTGKRKKL----LKQG 128
              :||...|.||..|    .|.|:.|| .|.|:|:..||::||   |..:..:::.:    |:..
Yeast   142 --RAKLERELLELRKKGGHIDEENILLEKQRESLRKFKLKQTE---DVGIVAQQQDISESNLRDE 201

  Fly   129 KNELAAALTDKDVLLEMSVNFKFDRQNALLEVHCEHPTDHSAQIVTGPI---------VHTNSLK 184
            .|.|   |.:...||.:. :.:.....|:.........|.|...:.|.:         :|:....
Yeast   202 DNNL---LDENGDLLPLE-SLELMPVEAMFLTFALPVLDISPACLAGKLFQFDAKYKDIHSFVRS 262

  Fly   185 YRVFKDLWRRGKYVTSGDAFGADFLVYPGDPMIYHASHIVILHEQPVIKPLELIAKV-RLSVIVN 248
            |.::......|..|.||..||.|:|:|...|...||...|:..:..|.|.....:.: |:.....
Yeast   263 YVIYHHYRSHGWCVRSGIKFGCDYLLYKRGPPFQHAEFCVMGLDHDVSKDYTWYSSIARVVGGAK 327

  Fly   249 KSCVFAY-EMENNEEE 263
            |:.|..| |...:|:|
Yeast   328 KTFVLCYVERLISEQE 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsen34NP_001036605.2 tRNA_int_endo 183..266 CDD:280199 23/83 (28%)
SEN2NP_013206.1 BAR 137..>185 CDD:416402 19/52 (37%)
endA 171..343 CDD:129424 40/178 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1676
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.