DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tsen34 and TSEN2

DIOPT Version :9

Sequence 1:	NP_001036605.2	Gene:	Tsen34 / 2768977	FlyBaseID:	FBgn0053260	Length:	276	Species:	Drosophila melanogaster
Sequence 2:	NP_001308207.1	Gene:	TSEN2 / 80746	HGNCID:	28422	Length:	516	Species:	Homo sapiens

Alignment Length:	131	Identity:	39/131 - (29%)
Similarity:	55/131 - (41%)	Gaps:	31/131 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   173 VTGPIVHTNSLKYRVFKDLWRRGKYVTSGDAFGADFLVYPGDPMIYHASHIVILH------EQPV 231
            |..|...|..:.|..|:.   :|.....|..:|.|.|:|...|..||||:.||:.      |..:
Human   334 VVQPTFRTTYMAYHYFRS---KGWVPKVGLKYGTDLLLYRKGPPFYHASYSVIIELVDDHFEGSL 395

  Fly   232 IKPL---ELIAKVRLSVIVNKSCVFAY----------EMENNE--EEIHYQT-------VAWCNL 274
            .:||   .|.|..|:||.|:|..:..|          |||:.|  :.|..|:       |..|:|
Human   396 RRPLSWKSLAALSRVSVNVSKELMLCYLIKPSTMTDKEMESPECMKRIKVQSRSVVQAGVQCCDL 460

  Fly   275 G 275
            |
Human   461 G 461

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tsen34	NP_001036605.2	tRNA_int_endo	183..266	CDD:280199	31/103 (30%)
TSEN2	NP_001308207.1	tRNA_int_endo_N	41..>68	CDD:280873
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	157..204
		tRNA_int_endo_N	<281..329	CDD:280873
		SEN2	<297..425	CDD:224590	29/93 (31%)
		tRNA_int_endo	339..422	CDD:280199	26/85 (31%)
		GVQW	450..497	CDD:290611	4/12 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1676
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900