DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsen34 and Tsen34

DIOPT Version :9

Sequence 1:NP_001036605.2 Gene:Tsen34 / 2768977 FlyBaseID:FBgn0053260 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_017167711.2 Gene:Tsen34 / 66078 MGIID:1913328 Length:357 Species:Mus musculus


Alignment Length:345 Identity:80/345 - (23%)
Similarity:138/345 - (40%) Gaps:102/345 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLTLLNGTGFVFNVDDYMELRSKHRIMGAPVGTANTKGWSPNQST---LPVELSKFETQLLLDE 62
            :.:.:.||...|:..:....||.:..:.|..|| |..:|  |.|::   ||:.|...|.:||.:.
Mouse    43 LVVEVANGRSLVWGAEAVQALRERLGVGGRTVG-ALPRG--PRQNSRLGLPLLLLPEEARLLAEI 104

  Fly    63 NIAKLVDKSKDLKAKPTAEKLEECKADFESRLLGQEEALKTE-----KLRETER--YMDKILTGK 120
            ....||.     ..:|.........|.|:.:   ||::.:.:     :.|||.|  .::||:.|:
Mouse   105 GAVTLVS-----APRPDPRNHGLALASFKRQ---QEQSFQDQNTLAAEARETRRQELLEKIVEGQ 161

  Fly   121 --RKKLLKQ-----------------------------GKNELAAALTDKD-------------- 140
              :|:.|:|                             .:.|.||...|..              
Mouse   162 AAKKQKLEQDSGADEGGQEAGGSEATQGSETSDDGQPSAEQEGAAPSLDSSSPQPGPSNGVTPLP 226

  Fly   141 ---VLLEMS------VNFKFDRQNALLEVHCEHPTDHSAQIVTGPIVH----TNSLKYRVFKDLW 192
               :|::::      |..|              |.|...|....|  |    .:.|:|.:::|||
Mouse   227 RSALLIQLATARPRPVKAK--------------PLDWRVQSKDWP--HAGRPAHELRYSIYRDLW 275

  Fly   193 RRGKYVTSGDAFGADFLVYPGDPMIYHASHIVIL--HEQPVIKPL-ELIAKVRLSVIVNKSCVFA 254
            .||.::::...||.|||||||||:.:||.:|...  .|.|:  || :|::..||...|.|:.:..
Mouse   276 ERGFFLSAAGKFGGDFLVYPGDPLRFHAHYIAQCWSAEDPI--PLQDLVSAGRLGTSVRKTLLLC 338

  Fly   255 YEMENNEEEIHYQTVAWCNL 274
            ....:.  ::.|.::.|.:|
Mouse   339 SPQPDG--KVVYTSLQWASL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsen34NP_001036605.2 tRNA_int_endo 183..266 CDD:280199 30/85 (35%)
Tsen34XP_017167711.2 tRNA_int_endo 264..348 CDD:376694 13/56 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847174
Domainoid 1 1.000 59 1.000 Domainoid score I10688
eggNOG 1 0.900 - - E1_COG1676
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52945
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005791
OrthoInspector 1 1.000 - - oto95356
orthoMCL 1 0.900 - - OOG6_102602
Panther 1 1.100 - - LDO PTHR13070
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2288
SonicParanoid 1 1.000 - - X4770
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.