powered by:
Protein Alignment Tsen34 and Tsen2
DIOPT Version :9
Sequence 1: | NP_001036605.2 |
Gene: | Tsen34 / 2768977 |
FlyBaseID: | FBgn0053260 |
Length: | 276 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_723994.2 |
Gene: | Tsen2 / 318956 |
FlyBaseID: | FBgn0051812 |
Length: | 233 |
Species: | Drosophila melanogaster |
Alignment Length: | 31 |
Identity: | 15/31 - (48%) |
Similarity: | 21/31 - (67%) |
Gaps: | 0/31 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 198 VTSGDAFGADFLVYPGDPMIYHASHIVILHE 228
:.||..||.|||:|...|.:||||.:||:.:
Fly 136 IKSGIKFGGDFLIYKQSPRLYHASFLVIVQK 166
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1676 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.