DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsen34 and Tsen2

DIOPT Version :9

Sequence 1:NP_001036605.2 Gene:Tsen34 / 2768977 FlyBaseID:FBgn0053260 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_723994.2 Gene:Tsen2 / 318956 FlyBaseID:FBgn0051812 Length:233 Species:Drosophila melanogaster


Alignment Length:31 Identity:15/31 - (48%)
Similarity:21/31 - (67%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 VTSGDAFGADFLVYPGDPMIYHASHIVILHE 228
            :.||..||.|||:|...|.:||||.:||:.:
  Fly   136 IKSGIKFGGDFLIYKQSPRLYHASFLVIVQK 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsen34NP_001036605.2 tRNA_int_endo 183..266 CDD:280199 15/31 (48%)
Tsen2NP_723994.2 tRNA_int_endo_N 32..105 CDD:280873
tRNA_int_endo 119..203 CDD:280199 15/31 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1676
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.