DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsen34 and tsen-34

DIOPT Version :9

Sequence 1:NP_001036605.2 Gene:Tsen34 / 2768977 FlyBaseID:FBgn0053260 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_741368.1 Gene:tsen-34 / 259566 WormBaseID:WBGene00019535 Length:201 Species:Caenorhabditis elegans


Alignment Length:144 Identity:39/144 - (27%)
Similarity:61/144 - (42%) Gaps:26/144 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 DVLLEMSVNFKF----------DR--QNALLEVHCEHPTDHSAQIVTGPIVHTNSLKYRVFKDLW 192
            |.|:.:.|.|.|          ||  |...||: .|.|.::|.:..|         |..|.:|.|
 Worm    66 DELVAILVEFGFANVIRLETTPDREIQRKTLEI-SEIPFENSKEFRT---------KRLVVRDFW 120

  Fly   193 RRGKYVTSGDAFGADFLVYPGDPMIYHASHIVILHEQPVIKPLELIAKVRLSVIVNKSCVFAYEM 257
            ::|.::..|..||.::|||...|...||..::|.  .|:... |.|:.:|....|.|:.:.| ..
 Worm   121 KKGYFIADGTRFGGNYLVYTSSPNTCHAEFVLIC--APITDE-ERISAMRCCNQVKKTLLLA-TT 181

  Fly   258 ENNEEEIHYQTVAW 271
            .:...:.||....|
 Worm   182 SSESTQPHYTQCTW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsen34NP_001036605.2 tRNA_int_endo 183..266 CDD:280199 22/82 (27%)
tsen-34NP_741368.1 tRNA_int_endo 109..184 CDD:376694 23/87 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164724
Domainoid 1 1.000 40 1.000 Domainoid score I8580
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005791
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102602
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.