DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsen34 and tsen-2

DIOPT Version :9

Sequence 1:NP_001036605.2 Gene:Tsen34 / 2768977 FlyBaseID:FBgn0053260 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_499543.2 Gene:tsen-2 / 176619 WormBaseID:WBGene00013231 Length:278 Species:Caenorhabditis elegans


Alignment Length:246 Identity:51/246 - (20%)
Similarity:94/246 - (38%) Gaps:74/246 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LPVELSKFETQLLL-----------------DENIAKLV-----------DKSKDLKAKPTAEKL 83
            :||.|:|.:.:.:|                 ||..::::           |:.|:.:....:...
 Worm    21 VPVALNKEDLEEVLGFRRIDAFLNGGLVEIFDETASRIIHEMSGIGQWLKDERKESRGVSRSCFS 85

  Fly    84 EECKADFESRLLGQEEALKTEKLRETERYMDKILTGKRKKLL----------KQGKNELAAALTD 138
            :.|..  .:..|.::.|.:..:|....|.:  :||.....||          |.||    .:|:|
 Worm    86 QSCGE--PNGKLNEQAANEWAELSPIARTL--VLTPIETALLSIDWKIINVVKNGK----ISLSD 142

  Fly   139 KDVLLEMSVNFKFDRQNALLEVHCEHPTDHSAQIVTGPIVHTNSLKYRVFKDLWRRGKYVTSGDA 203
            :::..||...:             ::|.:.      |.:       :.||:.|...|..||||..
 Worm   143 EEIWTEMRNLY-------------DNPKEF------GKV-------FSVFRFLKMNGWIVTSGHT 181

  Fly   204 FGADFLVYPGDPMIYHASHIVILHEQPVIKPLELIAKVRLSVIVNKSCVFA 254
            ||.|:|:|......||:|..|::.:  ||.|..|:...|:.....|:.:.|
 Worm   182 FGCDYLIYCLGAEFYHSSAGVLIAD--VIDPRRLLTLTRILSHNKKALIVA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsen34NP_001036605.2 tRNA_int_endo 183..266 CDD:280199 24/72 (33%)
tsen-2NP_499543.2 tRNA_int_endo 163..235 CDD:376694 24/70 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1676
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.