DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsen34 and Tsen34l1

DIOPT Version :9

Sequence 1:NP_001036605.2 Gene:Tsen34 / 2768977 FlyBaseID:FBgn0053260 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001300871.1 Gene:Tsen34l1 / 100909510 RGDID:6503363 Length:312 Species:Rattus norvegicus


Alignment Length:341 Identity:79/341 - (23%)
Similarity:137/341 - (40%) Gaps:98/341 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLTLLNGTGFVFNVDDYMELRSKHRIMGAPVGTANTKGWSPNQST---LPVELSKFETQLLLDE 62
            :.:.:.||...|:..:....||.:..:.|..|| |..:|  |.|::   ||:.|...|.:||.:.
  Rat     2 LVVEVANGRSLVWGAEAVQALRERLGVGGRTVG-ALPRG--PRQNSRLGLPLLLLPEEARLLAEI 63

  Fly    63 NIAKLVDKSKDLKAKPTAEKLEECKADFESRLLGQEEALKTE-----KLRETER--YMDKILTGK 120
            ....||.     ..:|.........|.|:.:   ||::.:.:     :.|||.|  .::||:.|:
  Rat    64 GAVTLVS-----APRPDPRNHGLALASFKRQ---QEQSFQDQSTLAAEARETRRQELLEKIVEGQ 120

  Fly   121 --RKKLLKQ------------GKNELAAALTDKD------------------------------V 141
              :|:.|:|            |......:.|..|                              :
  Rat   121 AAKKQKLEQDSGADEEGQEAGGSEATQGSETSDDGQASAEQEGADSSSPQPGPSNGVTPLPRSAL 185

  Fly   142 LLEMS------VNFKFDRQNALLEVHCEHPTDHSAQIVTGPIVH----TNSLKYRVFKDLWRRGK 196
            |::::      |..|              |.|...|....|  |    .:.|:|.:::|||.||.
  Rat   186 LIQLATARPRPVKAK--------------PLDWRVQSKDWP--HAGRPAHELRYSIYRDLWERGF 234

  Fly   197 YVTSGDAFGADFLVYPGDPMIYHASHIVIL--HEQPVIKPL-ELIAKVRLSVIVNKSCVFAYEME 258
            ::::...||.|||||||||:.:||.:|...  .|.|:  || :|::..||...|.|:.:......
  Rat   235 FLSAAGKFGGDFLVYPGDPLRFHAHYIAQCWSAEDPI--PLQDLVSAGRLGTSVRKTLLLCSPQP 297

  Fly   259 NNEEEIHYQTVAWCNL 274
            :.  ::.|.::.|.:|
  Rat   298 DG--KVVYTSLQWASL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsen34NP_001036605.2 tRNA_int_endo 183..266 CDD:280199 30/85 (35%)
Tsen34l1NP_001300871.1 tRNA-intron_lyase_C 220..308 CDD:411767 31/91 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350684
Domainoid 1 1.000 59 1.000 Domainoid score I10491
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52945
OrthoDB 1 1.010 - - D1621103at2759
OrthoFinder 1 1.000 - - FOG0005791
OrthoInspector 1 1.000 - - oto98843
orthoMCL 1 0.900 - - OOG6_102602
Panther 1 1.100 - - LDO PTHR13070
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4770
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.950

Return to query results.
Submit another query.