DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and AT2G36200

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001189688.1 Gene:AT2G36200 / 818192 AraportID:AT2G36200 Length:1040 Species:Arabidopsis thaliana


Alignment Length:117 Identity:44/117 - (37%)
Similarity:66/117 - (56%) Gaps:10/117 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVV---DVVGPREVVTRHTLDSK-LTKKFTFDRS 69
            |.:..|:...|:||.:|.||.:..|....:.:|:   |:  .|||.....:..| :.:.||||:.
plant     2 SSRHDKEKGVNVQVLLRCRPFSDDELRSNAPQVLTCNDL--QREVAVSQNIAGKHIDRVFTFDKV 64

  Fly    70 FGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGNNLRPPKSLYIEVRC 121
            |||.::|.|:|...|.|::.|||.|:|||:|||||||..    |:..:|..|
plant    65 FGPSAQQKDLYDQAVVPIVNEVLEGFNCTIFAYGQTGTG----KTYTMEGEC 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 37/92 (40%)
AT2G36200NP_001189688.1 KISc_BimC_Eg5 10..368 CDD:276815 42/109 (39%)
Kinesin 18..359 CDD:278646 39/101 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.