DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and AT2G28620

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001323772.1 Gene:AT2G28620 / 817411 AraportID:AT2G28620 Length:1042 Species:Arabidopsis thaliana


Alignment Length:148 Identity:53/148 - (35%)
Similarity:78/148 - (52%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SGGNTSRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPRE--VVTRHTLDSKLTKKFTF 66
            |..|...:.:|:...||||.||.||.||.|..:::..|:.....::  .|.::....::.|.|.|
plant    35 SNSNPVSKNEKEKGVNIQVIVRCRPFNSEETRLQTPAVLTCNDRKKEVAVAQNIAGKQIDKTFLF 99

  Fly    67 DRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGNNLRPPKSLYIEVRCMEDYGKFELD 131
            |:.|||.|:|.|:|...|||::.|||:|||||:|||||||..    |:..:|....:..|:...|
plant   100 DKVFGPTSQQKDLYHQAVSPIVFEVLDGYNCTIFAYGQTGTG----KTYTMEGGARKKNGEIPSD 160

  Fly   132 DGEVIHLKKNSQHYLPRA 149
            .|           .:|||
plant   161 AG-----------VIPRA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 40/90 (44%)
AT2G28620NP_001323772.1 KISc_BimC_Eg5 48..401 CDD:276815 50/135 (37%)
Smc 385..>634 CDD:224117
antiphage_ZorA_3 485..828 CDD:411477
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.