DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and Gins1

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_081290.1 Gene:Gins1 / 69270 MGIID:1916520 Length:196 Species:Mus musculus


Alignment Length:121 Identity:49/121 - (40%)
Similarity:72/121 - (59%) Gaps:16/121 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KLTKKFTFDRSFGPESKQCDVYSVVVSPL-----IEEV--LNGYNCTVFAY-----GQTG----N 107
            :.|..:.:||.....:.:.:..||:.:.|     .||.  .|.|..::..|     |..|    .
Mouse    74 RCTIAYLYDRLLRIRALRWEYGSVLPNSLRFHMSAEETEWFNHYKKSLATYMRSLGGDEGLDITQ 138

  Fly   108 NLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESLVRQGILHHI 163
            :::|||||||||||::|||:||:|||..:.|||||||:|||.:.|.|:|||:|.|:
Mouse   139 DVKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 12/58 (21%)
Gins1NP_081290.1 COG5230 1..191 CDD:227555 47/116 (41%)
GINS_A_psf1 3..130 CDD:212548 11/55 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003503
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.