DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and ncd

DIOPT Version :10

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_476651.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster


Alignment Length:209 Identity:54/209 - (25%)
Similarity:90/209 - (43%) Gaps:66/209 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDISGGNTSRQPQKKSNQNIQVYVRVR-PLNSRER---CIRSAEVVDVVGPREVVTRHTLDSKLT 61
            ||:.|             ||:|:.|:| ||.|.|.   |..:..      ....|...::|::..
  Fly   343 MDLRG-------------NIRVFCRIRPPLESEENRMCCTWTYH------DESTVELQSIDAQAK 388

  Fly    62 KK-----FTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTG--------------- 106
            .|     |:||:.|.|.|.|.|::. :|||||:..|:|||..:|||||||               
  Fly   389 SKMGQQIFSFDQVFHPLSSQSDIFE-MVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESVG 452

  Fly   107 ----------NNLRPPKSL----YIEVRCMEDYGK--FELDDGE----VIHLKKNSQH--YLPRA 149
                      :::|..::|    .|:...:|.|.:  ::|...|    .|.:.||:::  |:...
  Fly   453 VIPRTVDLLFDSIRGYRNLGWEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNI 517

  Fly   150 QVESLVRQGILHHI 163
            ..|:::....|.|:
  Fly   518 TEETVLDPNHLRHL 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:473979 35/97 (36%)
GINS_B_Psf1 115..163 CDD:412032 12/59 (20%)
ncdNP_476651.1 PRK03918 <204..350 CDD:235175 4/19 (21%)
KISc_C_terminal 346..672 CDD:276817 52/206 (25%)

Return to query results.
Submit another query.