DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and Klp98A

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_524532.2 Gene:Klp98A / 43310 FlyBaseID:FBgn0004387 Length:1265 Species:Drosophila melanogaster


Alignment Length:102 Identity:33/102 - (32%)
Similarity:53/102 - (51%) Gaps:13/102 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDS------KLTKKFTFDRSF------G 71
            :::|.|||||.||||..:.:..::::...:..:.:..|.|      .....||||.|:      .
  Fly     3 SLKVAVRVRPFNSREIDMDAQLIMEMENKKTRLLKPRLQSIRDAGRDNHHDFTFDYSYWSFDAED 67

  Fly    72 PE-SKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGN 107
            |. :.|..|||.:.:.:::....|||..||||||||:
  Fly    68 PHFATQEQVYSDLGNDVVDCAYEGYNACVFAYGQTGS 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 31/99 (31%)
Klp98ANP_524532.2 KISc_KIF1A_KIF1B 2..371 CDD:276816 33/102 (32%)
KISc 3..371 CDD:214526 33/102 (32%)
Kinesin_assoc 370..478 CDD:292801
FHA 456..555 CDD:238017
PX_KIF16B_SNX23 1131..1259 CDD:132784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437725
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.