DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and Klp67A

DIOPT Version :10

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_523992.2 Gene:Klp67A / 39068 FlyBaseID:FBgn0004379 Length:814 Species:Drosophila melanogaster


Alignment Length:171 Identity:50/171 - (29%)
Similarity:79/171 - (46%) Gaps:47/171 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KSNQNIQVYVRVRPLNSRE-----RCI-----RSAEVVD------------VVGPREVVTRHTLD 57
            :.:.||:|.|||||.|.||     |.|     |||.:.|            ...|...:|:    
  Fly     4 EQHTNIKVAVRVRPYNVRELEQKQRSIIKVMDRSALLFDPDEEDDEFFFQGAKQPYRDITK---- 64

  Fly    58 SKLTKKFT--FDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQT---------GNNLRP 111
             ::.||.|  |||.|..::...|::....:||::.|||||||:||.||.|         |:...|
  Fly    65 -RMNKKLTMEFDRVFDIDNSNQDLFEECTAPLVDAVLNGYNCSVFVYGATGAGKTFTMLGSEAHP 128

  Fly   112 ------PKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYL 146
                  .:.|:.:::...|..||::.   |.:|:..::|.:
  Fly   129 GLTYLTMQDLFDKIQAQSDVRKFDVG---VSYLEVYNEHVM 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:473979 41/121 (34%)
GINS_B_Psf1 115..163 CDD:412032 7/32 (22%)
Klp67ANP_523992.2 KISc_KIP3_like 8..346 CDD:276821 50/167 (30%)

Return to query results.
Submit another query.