DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and pav

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_477025.1 Gene:pav / 38515 FlyBaseID:FBgn0011692 Length:887 Species:Drosophila melanogaster


Alignment Length:135 Identity:40/135 - (29%)
Similarity:65/135 - (48%) Gaps:20/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVD----VVGPREVVTRHTL---DSKLTKKFTFD 67
            |....|:...:.|:.|||||.| :..:.|..|.:    .:.|::.:.:|..   .::...::.|.
  Fly    27 RDTSDKARDPVNVFCRVRPLQS-DADLTSLRVKNSTTIALNPQDQLLQHHKPHNGAQREVQYIFK 90

  Fly    68 RSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGN--------NLR----PPKSLYIEVR 120
            ..|.|::.|.|||:.|..||:|.:|.|.|..:|.||.||:        |||    .|:.|.:..|
  Fly    91 HVFQPDATQQDVYAAVAQPLVENLLKGRNSLLFTYGVTGSGKTYTMTGNLRHRGIMPRCLDVLFR 155

  Fly   121 CMEDY 125
            .:.||
  Fly   156 TISDY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 28/95 (29%)
pavNP_477025.1 KISc_KIF23_like 35..450 CDD:276819 38/127 (30%)
Kinesin 42..452 CDD:278646 37/120 (31%)
MKLP1_Arf_bdg 735..837 CDD:293148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437903
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.