DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and Psf1

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster


Alignment Length:188 Identity:78/188 - (41%)
Similarity:95/188 - (50%) Gaps:53/188 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LNSRERCIRSAEVVDVVGPREVV--TRHTLDSKLTKKFTF----DRSFGP----------ESKQC 77
            |...||..::....|..|.|:|:  .:...:..:.:..::    |||..|          .:|:|
  Fly    16 LKELERSSQTIPAFDDDGVRQVLEEIKAIFEENVAQASSYNASGDRSLWPLLNFRHAALQRNKRC 80

  Fly    78 -------------------------DVYSVVVSPLI------EEVLNGYNCTVFAYGQ-----TG 106
                                     |:...:..|.:      .:.|..|.|:. .|.|     ..
  Fly    81 LLAYLYERCRRIKALRWEFGPIIPGDIKQALCEPEVTFFNNYSKSLAAYMCSA-GYNQGLPIDLT 144

  Fly   107 NNLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESLVRQGILHHIA 164
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   145 NNLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESLVRQGILHHIA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 20/128 (16%)
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 18/118 (15%)
GINS_B 153..201 CDD:425409 47/47 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5230
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249159at2759
OrthoFinder 1 1.000 - - FOG0003503
OrthoInspector 1 1.000 - - otm3552
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.