DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and cana

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001027247.1 Gene:cana / 3771934 FlyBaseID:FBgn0040233 Length:1931 Species:Drosophila melanogaster


Alignment Length:99 Identity:24/99 - (24%)
Similarity:42/99 - (42%) Gaps:21/99 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KSNQNIQVYVRVRPLNSRERCI------RSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPE 73
            |:..:|||.::|||.......:      ||.::.|         .|      .:.:.||..|...
  Fly     4 KNASSIQVCIKVRPCEPGLTSLWQVKEGRSIQLAD---------SH------AEPYVFDYVFDEG 53

  Fly    74 SKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGN 107
            :...:|:..:...::...:.|.|.|:||||||.:
  Fly    54 ASNQEVFDRMAKHIVHACMQGSNGTIFAYGQTSS 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 22/94 (23%)
canaNP_001027247.1 KISc 8..316 CDD:214526 23/95 (24%)
Motor_domain 8..310 CDD:277568 23/95 (24%)
SMC_prok_B <471..1270 CDD:274008
Mplasa_alph_rch 924..1647 CDD:275316
CENP-H 1204..>1266 CDD:283493
CALCOCO1 <1489..1850 CDD:285171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.