DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and Klp59D

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_611762.1 Gene:Klp59D / 37674 FlyBaseID:FBgn0034827 Length:729 Species:Drosophila melanogaster


Alignment Length:114 Identity:39/114 - (34%)
Similarity:54/114 - (47%) Gaps:17/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDISGGNTSRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSK--LTK- 62
            :|.:||..         |.|.|.||.||::.:|...::.:::.|.....::. |.|..|  ||| 
  Fly   224 LDPNGGTV---------QQITVCVRKRPMSRKEENSKNLDIITVPSADSLIV-HELRLKVDLTKF 278

  Fly    63 ----KFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGN 107
                ||.||.:|..|.....||.....|||..:..|.|.|.|||||||:
  Fly   279 LEHHKFRFDYTFDEECSNALVYDHTARPLIRTMFEGGNATCFAYGQTGS 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 34/95 (36%)
Klp59DNP_611762.1 KISc_KIF2_like 233..565 CDD:276818 35/96 (36%)
Kinesin 239..566 CDD:278646 32/90 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.