DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and Khc-73

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001261000.1 Gene:Khc-73 / 36718 FlyBaseID:FBgn0019968 Length:1957 Species:Drosophila melanogaster


Alignment Length:173 Identity:49/173 - (28%)
Similarity:69/173 - (39%) Gaps:53/173 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SNQNIQVYVRVRPLNSRE-----RCIRSAE----VVDVVGPREVVTRHTLDSKLTKKFTFDRSF- 70
            ::..|:|.|||||.|.||     :||...|    ::....|.|.:.|     |..|.|.||..| 
  Fly     2 ASDKIKVAVRVRPFNRREIELDTKCIVEMEKQQTILQNPPPLEKIER-----KQPKTFAFDHCFY 61

  Fly    71 --GPE----SKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGN---------------------- 107
              .||    :.|..|:..|...:::....|||..:|||||||:                      
  Fly    62 SLNPEDENFASQETVFDCVGRGILDNAFQGYNACIFAYGQTGSGKSYTMMGTQESKGIIPRLCDQ 126

  Fly   108 ------NLRPPKSLY-IEVRCMEDYGKFELDDGEVIHLKKNSQ 143
                  |...|:.:| :||..||.|.:...|   ::..|.|.|
  Fly   127 LFSAIANKSTPELMYKVEVSYMEIYNEKVHD---LLDPKPNKQ 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 35/104 (34%)
Khc-73NP_001261000.1 KISc_KIF1A_KIF1B 4..359 CDD:276816 49/171 (29%)
KISc 6..359 CDD:214526 49/169 (29%)
Kinesin_assoc 356..468 CDD:292801
FHA 446..546 CDD:238017
KIF1B 741..786 CDD:289208
DUF3694 <1196..1252 CDD:289256
CAP_GLY 1786..1850 CDD:279625
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437748
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.