DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and Klp31E

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001162935.1 Gene:Klp31E / 34422 FlyBaseID:FBgn0032243 Length:1048 Species:Drosophila melanogaster


Alignment Length:96 Identity:39/96 - (40%)
Similarity:53/96 - (55%) Gaps:15/96 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSK-----LTKKFTFDRSFGPESKQ 76
            :.:::|.||:||.|||       |::|:.   .:.|..||...     ..|.||||..|...|.|
  Fly    11 DSSVRVAVRIRPQNSR-------ELIDMC---RICTTVTLGEPQIFLGSDKAFTFDYVFDTNSNQ 65

  Fly    77 CDVYSVVVSPLIEEVLNGYNCTVFAYGQTGN 107
            ||:||..|..|::..|:|||.||.||||||:
  Fly    66 CDIYSDCVEKLVDSTLHGYNATVLAYGQTGS 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 37/93 (40%)
Klp31ENP_001162935.1 KISc_KIF4 12..364 CDD:276823 39/95 (41%)
KISc 13..370 CDD:214526 39/94 (41%)
KASH_CCD 409..589 CDD:291334
RasGAP <685..750 CDD:295371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437894
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.