DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32318 and CG5004

DIOPT Version :9

Sequence 1:	NP_995952.1	Gene:	CG32318 / 2768976	FlyBaseID:	FBgn0052318	Length:	164	Species:	Drosophila melanogaster
Sequence 2:	NP_573195.1	Gene:	CG5004 / 32698	FlyBaseID:	FBgn0260748	Length:	1247	Species:	Drosophila melanogaster

Alignment Length:	62	Identity:	15/62 - (24%)
Similarity:	26/62 - (41%)	Gaps:	19/62 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly    47 PREVVTRHTLDSKLTKKFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGNN 108
            |::::|:...|       .:||.  |::....:||          :||.|..:.....||||
  Fly   251 PQDLLTKVNND-------RYDRY--PKAGGLQIYS----------MNGVNSDINNGPATGNN 293

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32318	NP_995952.1	Motor_domain	17..>106	CDD:277568	11/58 (19%)
CG5004	NP_573195.1	FHA	41..104	CDD:278899
		PH-like	1142..1242	CDD:302622
		PH	1143..1237	CDD:278594
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45437899
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930