DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and cut7

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_594527.1 Gene:cut7 / 2542732 PomBaseID:SPAC25G10.07c Length:1085 Species:Schizosaccharomyces pombe


Alignment Length:179 Identity:54/179 - (30%)
Similarity:79/179 - (44%) Gaps:39/179 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGP--REVVTRHTLDSKL-TKKFTFDRSFGPESKQ 76
            ::..||.|.||||....:|....|:..|...|.  .|:..:....|.| ||.:.||:.||||:.|
pombe    68 ENETNINVVVRVRGRTDQEVRDNSSLAVSTSGAMGAELAIQSDPSSMLVTKTYAFDKVFGPEADQ 132

  Fly    77 CDVYSVVVSPLIEEVLNGYNCTVFAYGQTGNNLR--------------------PPKSLY----- 116
            ..::...|:|::|:||||||||:|||||||....                    .|::||     
pombe   133 LMLFENSVAPMLEQVLNGYNCTIFAYGQTGTGKTYTMSGDLSDSDGILSEGAGLIPRALYQLFSS 197

  Fly   117 -------IEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESLVRQG 158
                   ..|:|    ..:||.:.|:..|..:.:...|....|...|:|
pombe   198 LDNSNQEYAVKC----SYYELYNEEIRDLLVSEELRKPARVFEDTSRRG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 39/91 (43%)
cut7NP_594527.1 KISc_BimC_Eg5 70..429 CDD:276815 54/177 (31%)
KISc 72..428 CDD:214526 54/175 (31%)
SbcC <398..>966 CDD:223496
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.