DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and psf1

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_595821.1 Gene:psf1 / 2541324 PomBaseID:SPBP23A10.09 Length:202 Species:Schizosaccharomyces pombe


Alignment Length:105 Identity:36/105 - (34%)
Similarity:53/105 - (50%) Gaps:19/105 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LDSKLTKKFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGNNLRPPKSLYIEVR 120
            ||:.|:   |::|.:      ...||        |:|..|.........|| :|.|||:|:|:||
pombe   114 LDTSLS---TYERDY------LTRYS--------ELLAAYKGAWSELDLTG-SLVPPKNLFIDVR 160

  Fly   121 CMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESLVRQGIL 160
            .::|.|..|.:.| .|:|.||||.::....||.|:.||.|
pombe   161 VLKDVGDIETEYG-TINLTKNSQLHVRATDVERLIAQGFL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 10/49 (20%)
psf1NP_595821.1 COG5230 1..202 CDD:227555 36/105 (34%)
GINS_A_psf1 6..140 CDD:212548 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 46 1.000 Domainoid score I3540
eggNOG 1 0.900 - - E1_COG5230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003503
OrthoInspector 1 1.000 - - otm47003
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.