DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and psf-1

DIOPT Version :10

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_496153.2 Gene:psf-1 / 187885 WormBaseID:WBGene00011275 Length:201 Species:Caenorhabditis elegans


Alignment Length:79 Identity:35/79 - (44%)
Similarity:49/79 - (62%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EVLNGYNCTVFAY----GQTGNNL----RPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYL 146
            :..|.|:.|:..:    |:.|.||    .|||||:::||.:||||:||..||..:.|.|:|.|.|
 Worm   119 QFFNEYSSTLARFQSNLGE
GGVNLLLHSAPPKSLFVQVRALEDYGEFETSDGTQVQLSKDSLHSL 183

  Fly   147 PRAQVESLVRQGIL 160
            ||...|.|:|||:|
 Worm   184 PRQDCEMLIRQGVL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:473979 4/19 (21%)
GINS_B_Psf1 115..163 CDD:412032 24/46 (52%)
psf-1NP_496153.2 GINS_A_psf1 12..137 CDD:212548 3/17 (18%)
GINS_B_Psf1 152..200 CDD:412032 24/46 (52%)

Return to query results.
Submit another query.