DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and psf-1

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_496153.2 Gene:psf-1 / 187885 WormBaseID:WBGene00011275 Length:201 Species:Caenorhabditis elegans


Alignment Length:79 Identity:35/79 - (44%)
Similarity:49/79 - (62%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EVLNGYNCTVFAY----GQTGNNL----RPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYL 146
            :..|.|:.|:..:    |:.|.||    .|||||:::||.:||||:||..||..:.|.|:|.|.|
 Worm   119 QFFNEYSSTLARFQSNLGEGGVNLLLHSAPPKSLFVQVRALEDYGEFETSDGTQVQLSKDSLHSL 183

  Fly   147 PRAQVESLVRQGIL 160
            ||...|.|:|||:|
 Worm   184 PRQDCEMLIRQGVL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 4/19 (21%)
psf-1NP_496153.2 GINS_A_psf1 12..137 CDD:212548 3/17 (18%)
COG5230 18..200 CDD:227555 35/79 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I6536
eggNOG 1 0.900 - - E1_COG5230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249159at2759
OrthoFinder 1 1.000 - - FOG0003503
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.