DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and bmk-1

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001379525.1 Gene:bmk-1 / 179948 WormBaseID:WBGene00000257 Length:963 Species:Caenorhabditis elegans


Alignment Length:155 Identity:49/155 - (31%)
Similarity:76/155 - (49%) Gaps:32/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKKF-TFDRSFGP 72
            ||:...:...|::|.||:||:|..||..:...||.|...::.:      ....|.| .|.|::.|
 Worm     8 SRKKHSEPTSNLRVAVRIRPMNGTERSEKCTNVVKVDKGKQAI------ELKGKSFGPFFRTYDP 66

  Fly    73 ESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGNNLRPPKSLYIEVRCMEDYGK-FELDDGEVI 136
            ::.|.::||.:||..|::|:.|:|||||||||||.                  || |.::.|.. 
 Worm    67 DTTQEEIYSDLVSSQIKKVIAGFNCTVFAYGQTGT------------------GKTFTMEGGRT- 112

  Fly   137 HLKKNSQH----YLPRAQVESLVRQ 157
            ..|.::..    .:||| ||.:..|
 Worm   113 DAKSSTDDPTTGIIPRA-VEDIFEQ 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 34/89 (38%)
bmk-1NP_001379525.1 Motor_domain 17..359 CDD:419868 47/146 (32%)
CCDC158 <365..>839 CDD:318193
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.