DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and Kif11

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001162583.1 Gene:Kif11 / 171304 RGDID:621258 Length:1056 Species:Rattus norvegicus


Alignment Length:120 Identity:50/120 - (41%)
Similarity:71/120 - (59%) Gaps:10/120 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NTSRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHT--LDSKLTKK-FTFDR 68
            ::|.:.:::..:||||.||.||.|..||...:..||:....|:.|:..|  |..|.::| :|||.
  Rat     6 SSSSKKKEEKGKNIQVVVRCRPFNLAERKANAHSVVECDHARKEVSVRTAGLTDKTSRKTYTFDM 70

  Fly    69 SFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGNNL-------RPPKSLY 116
            .||..:||.|||..||.|:::||:.|||||:|||||||...       |.|..:|
  Rat    71 VFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSPNEVY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 44/91 (48%)
Kif11NP_001162583.1 KISc_BimC_Eg5 16..368 CDD:276815 49/110 (45%)
KISc 18..366 CDD:214526 49/108 (45%)
DUF4795 416..>486 CDD:292662
Microtub_bind 916..1052 CDD:290642
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.